Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2359
Gene name
LocationContig_172:7495..10459
Strand-
Gene length (bp)2964
Transcript length (bp)2802
Coding sequence length (bp)2802
Protein length (aa) 934

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 4.0E-34 660 846

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7J5|YOI9_SCHPO TBC domain-containing protein C1778.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.09 PE=3 SV=1 565 925 1.0E-69
sp|Q80XC3|US6NL_MOUSE USP6 N-terminal-like protein OS=Mus musculus GN=Usp6nl PE=1 SV=2 610 848 6.0E-28
sp|Q92738|US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens GN=USP6NL PE=1 SV=3 607 848 2.0E-27
sp|Q5R372|RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens GN=RABGAP1L PE=1 SV=1 656 902 1.0E-22
sp|Q5RCW6|RBG1L_PONAB Rab GTPase-activating protein 1-like OS=Pongo abelii GN=RABGAP1L PE=2 SV=1 656 902 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7J5|YOI9_SCHPO TBC domain-containing protein C1778.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.09 PE=3 SV=1 565 925 1.0E-69
sp|Q80XC3|US6NL_MOUSE USP6 N-terminal-like protein OS=Mus musculus GN=Usp6nl PE=1 SV=2 610 848 6.0E-28
sp|Q92738|US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens GN=USP6NL PE=1 SV=3 607 848 2.0E-27
sp|Q5R372|RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens GN=RABGAP1L PE=1 SV=1 656 902 1.0E-22
sp|Q5RCW6|RBG1L_PONAB Rab GTPase-activating protein 1-like OS=Pongo abelii GN=RABGAP1L PE=2 SV=1 656 902 3.0E-22
sp|Q5ZJ17|RBG1L_CHICK Rab GTPase-activating protein 1-like OS=Gallus gallus GN=RABGAP1L PE=2 SV=1 655 902 1.0E-21
sp|Q5RAN1|RBGP1_PONAB Rab GTPase-activating protein 1 OS=Pongo abelii GN=RABGAP1 PE=2 SV=1 640 902 2.0E-21
sp|Q9Y3P9|RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens GN=RABGAP1 PE=1 SV=3 640 902 2.0E-21
sp|A6H6A9|RBG1L_MOUSE Rab GTPase-activating protein 1-like OS=Mus musculus GN=Rabgap1l PE=1 SV=1 656 902 5.0E-21
sp|A2AWA9|RBGP1_MOUSE Rab GTPase-activating protein 1 OS=Mus musculus GN=Rabgap1 PE=1 SV=1 644 902 5.0E-21
sp|Q96CN4|EVI5L_HUMAN EVI5-like protein OS=Homo sapiens GN=EVI5L PE=1 SV=1 641 886 7.0E-19
sp|Q755I4|GYP5_ASHGO GTPase-activating protein GYP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GYP5 PE=3 SV=2 648 848 1.0E-18
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus musculus GN=Tbc1d10b PE=1 SV=2 645 848 1.0E-18
sp|Q4KMP7|TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens GN=TBC1D10B PE=1 SV=3 645 848 6.0E-18
sp|O60447|EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens GN=EVI5 PE=1 SV=3 643 908 1.0E-17
sp|Q60949|TBCD1_MOUSE TBC1 domain family member 1 OS=Mus musculus GN=Tbc1d1 PE=1 SV=3 561 849 2.0E-17
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 645 848 3.0E-17
sp|Q12344|GYP5_YEAST GTPase-activating protein GYP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP5 PE=1 SV=1 656 848 8.0E-17
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 645 848 2.0E-16
sp|Q8BYJ6|TBCD4_MOUSE TBC1 domain family member 4 OS=Mus musculus GN=Tbc1d4 PE=1 SV=2 655 908 3.0E-16
sp|O97790|TBCD1_BOVIN TBC1 domain family member 1 OS=Bos taurus GN=TBC1D1 PE=2 SV=2 561 849 3.0E-16
sp|Q86TI0|TBCD1_HUMAN TBC1 domain family member 1 OS=Homo sapiens GN=TBC1D1 PE=1 SV=2 561 849 4.0E-16
sp|Q8IV04|TB10C_HUMAN Carabin OS=Homo sapiens GN=TBC1D10C PE=1 SV=1 645 845 1.0E-15
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 596 848 7.0E-15
sp|O60343|TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens GN=TBC1D4 PE=1 SV=2 655 849 2.0E-14
sp|Q8C9V1|TB10C_MOUSE Carabin OS=Mus musculus GN=Tbc1d10c PE=1 SV=1 645 845 3.0E-14
sp|A0A087WXS9|TBC3I_HUMAN TBC1 domain family member 3I OS=Homo sapiens GN=TBC1D3I PE=3 SV=1 596 848 4.0E-13
sp|Q9VYY9|EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster GN=Evi5 PE=1 SV=3 645 902 4.0E-13
sp|B9A6J9|TBC3L_HUMAN TBC1 domain family member 3L OS=Homo sapiens GN=TBC1D3L PE=2 SV=1 611 848 5.0E-13
sp|A0A087WVF3|TBC3D_HUMAN TBC1 domain family member 3D OS=Homo sapiens GN=TBC1D3D PE=2 SV=1 611 848 5.0E-13
sp|Q6IPX1|TBC3C_HUMAN TBC1 domain family member 3C OS=Homo sapiens GN=TBC1D3C PE=2 SV=3 596 848 5.0E-13
sp|Q8IZP1|TBC3A_HUMAN TBC1 domain family member 3 OS=Homo sapiens GN=TBC1D3 PE=1 SV=6 596 848 5.0E-13
sp|A0A087X1G2|TBC3K_HUMAN TBC1 domain family member 3K OS=Homo sapiens GN=TBC1D3K PE=3 SV=1 611 848 6.0E-13
sp|A0A087X179|TBC3E_HUMAN TBC1 domain family member 3E OS=Homo sapiens GN=TBC1D3E PE=2 SV=1 611 848 8.0E-13
sp|A6NER0|TBC3F_HUMAN TBC1 domain family member 3F OS=Homo sapiens GN=TBC1D3F PE=2 SV=3 611 848 1.0E-12
sp|P97366|EVI5_MOUSE Ecotropic viral integration site 5 protein OS=Mus musculus GN=Evi5 PE=1 SV=2 620 908 1.0E-12
sp|P0C7X1|TBC3H_HUMAN TBC1 domain family member 3H OS=Homo sapiens GN=TBC1D3H PE=2 SV=3 596 848 2.0E-12
sp|A6NDS4|TBC3B_HUMAN TBC1 domain family member 3B OS=Homo sapiens GN=TBC1D3B PE=2 SV=2 611 848 3.0E-12
sp|Q6DHY5|TBC3G_HUMAN TBC1 domain family member 3G OS=Homo sapiens GN=TBC1D3G PE=2 SV=2 596 848 4.0E-12
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 645 845 1.0E-10
sp|O60347|TBC12_HUMAN TBC1 domain family member 12 OS=Homo sapiens GN=TBC1D12 PE=1 SV=3 595 905 2.0E-10
sp|Q10496|GYP51_SCHPO GTPase activating protein Gyp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp51 PE=3 SV=1 729 850 2.0E-10
sp|Q6A039|TBC12_MOUSE TBC1 domain family member 12 OS=Mus musculus GN=Tbc1d12 PE=1 SV=2 595 905 2.0E-10
sp|Q8CGA2|TBC14_MOUSE TBC1 domain family member 14 OS=Mus musculus GN=Tbc1d14 PE=1 SV=2 515 905 2.0E-10
sp|Q5CD77|TBC14_RAT TBC1 domain family member 14 OS=Rattus norvegicus GN=Tbc1d14 PE=2 SV=2 515 905 2.0E-10
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 656 849 5.0E-10
sp|Q0IHY4|TBC12_XENTR TBC1 domain family member 12 OS=Xenopus tropicalis GN=tbc1d12 PE=2 SV=1 603 905 6.0E-10
sp|Q28CB1|TBD2B_XENTR TBC1 domain family member 2B OS=Xenopus tropicalis GN=tbc1d2b PE=2 SV=1 647 849 7.0E-10
sp|Q9P2M4|TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens GN=TBC1D14 PE=1 SV=3 601 905 2.0E-09
sp|A6H7I8|TBC14_BOVIN TBC1 domain family member 14 OS=Bos taurus GN=TBC1D14 PE=2 SV=2 704 905 3.0E-09
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 645 849 4.0E-09
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 645 849 4.0E-09
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 655 845 6.0E-09
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 612 848 7.0E-09
sp|Q5SVR0|TBC9B_MOUSE TBC1 domain family member 9B OS=Mus musculus GN=Tbc1d9b PE=1 SV=1 633 908 1.0E-08
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 645 849 1.0E-08
sp|Q3U0J8|TBD2B_MOUSE TBC1 domain family member 2B OS=Mus musculus GN=Tbc1d2b PE=1 SV=2 646 848 1.0E-08
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 645 849 4.0E-08
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 612 848 4.0E-08
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 645 849 9.0E-08
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 655 848 1.0E-07
sp|Q9UPU7|TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens GN=TBC1D2B PE=1 SV=2 647 848 3.0E-07
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 655 849 5.0E-07
sp|P53258|GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDR1 PE=1 SV=1 644 849 8.0E-07
sp|Q86UD7|TBC26_HUMAN TBC1 domain family member 26 OS=Homo sapiens GN=TBC1D26 PE=2 SV=3 610 772 4.0E-06
sp|Q9D3N8|GRTP1_MOUSE Growth hormone-regulated TBC protein 1 OS=Mus musculus GN=Grtp1 PE=1 SV=1 615 849 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2359
MPSRFPSVRQPARPGMGMPRPSFLDDSSLVALRYEKTKPAEPPIPLPPARAPRRACSVASTTKSARTGQSASSNL
SSPAPSPGLVVVAPPSGYFVPAPGLIPPAEQHPALRTSVSAASARALDDRKRDSGHAPTAASSATIHEEDEEDEV
HGRAQGKQRSSGAVQPAAHGATEQSGRGLRFAGHAAALPPPGSCCSSCSPSSSPPPSPKPSLRRLLSKHGSLHLT
RSRSRSSQSAKAAETLAPMQPQTQTQTPKSLLRGPAPPLSANGSLPTVAMADSLSPAFCPDQAAGFSPLSIAIPT
DNLIDDDFMAGFSFSKRGSIMFGGQRAMPSDADGASDALPSSLLSMAPLSQAPTRTAHSSSASSLPKDAASTSHG
THPAPLPDFRLLPADVEKDSLKVRSLYAAADSVSWEEGMRHSFCERLEPTPEVPVQETDNDARAAPLSSAIAISR
CASAFSHRPDSLGRDTTQLAGGLEDWQDINGADVDRYGFINAPRPTSRISTPTELKSSQFSPRRRNLLHKRDPMG
FSSQLGGGRMPSRKVSARSLNTQNSEMSVASGRSGRSVLRQASNLLPHNRNRRWMDEAGDMLTVSPSLQDIVEEA
QVEKISEAIKRKEWERSEKWRKMAKVVNRGDEDQGQGMEFEFDVRNPKLVERTWKGIPDRWRAAAWWSFLASAAK
EHPSSASVEHLVAAFYDLLEKSSPDDVQIDLDVPRTINRHIMFRRRYRGGQRLLFRVLHCLSIYFPDTGYVQGMA
SLAATLLCYFDEEKCFVMLVRMWELRGLSRLYRPGFEGLMAALDEFKTHWLHEQVANRLSELCVDTTAYGTRWYL
TLFNLSIPFAAQLRVWDVFLLLGSGDDKQEQDMAEAQAAHEPAISPTGLDVLHATAAALMQALREVLLDADFENA
MKALTSWISIKDEELLMKVTKAEWKTHHGKRKA*
Coding >OphauB2|2359
ATGCCGTCGAGATTTCCGTCGGTGCGTCAACCAGCGCGGCCCGGCATGGGCATGCCCAGGCCGTCTTTTCTCGAC
GACTCGAGTCTTGTGGCTCTGCGATACGAAAAAACCAAGCCAGCTGAGCCGCCCATTCCTTTGCCTCCGGCTCGC
GCGCCTCGCAGAGCATGCAGCGTGGCAAGCACGACAAAATCAGCAAGGACAGGCCAGTCTGCATCGTCGAACCTG
TCGTCGCCTGCGCCTAGTCCGGGCCTGGTTGTCGTTGCCCCTCCGTCGGGCTACTTTGTCCCGGCGCCCGGCCTC
ATTCCACCGGCCGAGCAGCATCCGGCGCTGCGGACATCAGTCTCAGCCGCCTCGGCTCGGGCCCTGGACGACAGG
AAGCGAGACTCGGGCCATGCTCCGACGGCGGCGTCGTCGGCAACAATTCACGAAGAGGACGAAGAGGACGAGGTG
CACGGTAGAGCCCAAGGCAAGCAACGGAGCTCTGGTGCCGTGCAACCGGCTGCTCATGGCGCAACAGAGCAAAGT
GGACGAGGTCTCAGATTTGCTGGCCACGCTGCCGCCTTGCCCCCGCCTGGCTCATGCTGCTCCTCTTGCTCGCCA
TCGTCGTCGCCGCCTCCATCGCCCAAGCCGTCGCTCCGGAGGCTGCTCTCCAAGCACGGCAGCCTGCACCTGACA
AGGTCAAGGTCCAGGTCGAGCCAGTCTGCCAAGGCGGCAGAAACATTAGCGCCCATGCAGCCGCAAACGCAAACG
CAAACGCCCAAGTCGCTGCTGCGGGGCCCGGCTCCCCCGCTCTCAGCCAATGGCAGCCTGCCGACTGTCGCCATG
GCCGATTCCTTGTCCCCAGCCTTTTGCCCCGACCAAGCTGCCGGCTTTTCTCCCCTGTCCATTGCCATCCCAACC
GATAACCTTATCGACGATGACTTCATGGCCGGCTTTTCCTTTTCCAAGCGCGGCAGCATCATGTTTGGCGGCCAA
CGCGCAATGCCTTCTGACGCTGACGGCGCCTCGGACGCGCTGCCCTCGTCTCTGCTCTCCATGGCACCCTTGAGC
CAAGCCCCGACAAGGACGGCCCACAGCTCGAGCGCATCCTCTCTCCCCAAGGATGCCGCTTCCACTAGCCATGGC
ACCCACCCCGCCCCACTGCCCGACTTTCGCCTGCTGCCGGCCGACGTTGAAAAGGACTCCTTAAAGGTGAGGTCG
CTGTATGCAGCTGCCGATTCTGTCAGCTGGGAAGAGGGCATGAGGCACTCGTTTTGCGAGCGCCTCGAACCCACG
CCCGAGGTCCCAGTCCAAGAGACGGACAATGACGCACGCGCTGCGCCTCTTTCGTCTGCAATAGCTATTTCAAGA
TGCGCAAGTGCCTTTTCGCATCGACCTGACAGTCTTGGTCGCGACACGACGCAGTTGGCTGGCGGTCTTGAGGAC
TGGCAAGACATCAATGGCGCCGACGTGGATCGCTATGGCTTCATCAATGCCCCTCGCCCAACATCGCGTATCAGC
ACGCCAACCGAGCTCAAGTCGTCGCAGTTTTCTCCTAGGCGGAGAAATCTCCTCCACAAGAGGGACCCCATGGGC
TTCTCGTCACAGCTTGGAGGCGGCCGCATGCCCAGCCGCAAGGTGTCGGCCCGTTCTCTCAATACCCAAAACTCG
GAAATGTCTGTTGCTTCGGGGCGCTCTGGCCGATCGGTCCTGCGCCAAGCAAGCAACCTGCTGCCCCATAACCGT
AACCGGCGCTGGATGGACGAGGCTGGTGACATGTTGACTGTCTCTCCCAGTTTGCAAGACATTGTCGAGGAGGCC
CAGGTGGAAAAGATATCCGAAGCCATCAAGCGCAAAGAGTGGGAGAGATCGGAAAAGTGGCGCAAAATGGCCAAG
GTGGTCAACCGGGGCGACGAGGACCAGGGCCAAGGCATGGAGTTCGAGTTTGATGTGCGCAACCCCAAGCTAGTT
GAGCGGACGTGGAAGGGCATCCCCGACCGGTGGCGCGCCGCTGCCTGGTGGTCCTTTCTTGCCTCGGCTGCCAAG
GAGCATCCCTCGTCGGCCTCGGTCGAGCATCTCGTGGCTGCCTTTTACGACTTGCTGGAAAAGAGCTCTCCAGAT
GACGTGCAGATTGATCTCGATGTGCCTCGCACCATTAACCGTCACATCATGTTTCGACGCCGCTACCGGGGGGGG
CAGCGTCTTCTCTTTCGCGTCCTGCACTGCTTGTCCATTTACTTTCCCGACACGGGATACGTGCAGGGCATGGCT
TCGCTAGCTGCCACACTTCTCTGCTACTTTGATGAGGAAAAGTGCTTCGTGATGCTGGTTCGCATGTGGGAGCTG
CGAGGCCTCAGCCGCCTCTACCGTCCCGGATTCGAGGGGCTCATGGCGGCCCTTGACGAGTTCAAGACGCACTGG
CTTCACGAACAGGTGGCAAACAGGCTGTCGGAGCTTTGTGTCGATACAACGGCTTACGGGACGCGCTGGTACCTG
ACGCTCTTTAATCTCTCGATTCCCTTTGCCGCTCAACTTCGCGTCTGGGACGTGTTTTTGCTGCTCGGCTCTGGT
GACGACAAGCAGGAGCAAGACATGGCCGAGGCGCAAGCCGCTCACGAGCCTGCCATCTCGCCGACTGGGCTCGAT
GTGCTGCACGCGACGGCAGCGGCTCTGATGCAGGCACTGCGAGAGGTGCTCCTCGATGCCGACTTTGAAAACGCC
ATGAAGGCACTGACGTCGTGGATATCCATCAAGGACGAAGAGCTGCTGATGAAGGTGACCAAGGCGGAGTGGAAG
ACGCACCACGGCAAGAGGAAAGCGTAG
Transcript >OphauB2|2359
ATGCCGTCGAGATTTCCGTCGGTGCGTCAACCAGCGCGGCCCGGCATGGGCATGCCCAGGCCGTCTTTTCTCGAC
GACTCGAGTCTTGTGGCTCTGCGATACGAAAAAACCAAGCCAGCTGAGCCGCCCATTCCTTTGCCTCCGGCTCGC
GCGCCTCGCAGAGCATGCAGCGTGGCAAGCACGACAAAATCAGCAAGGACAGGCCAGTCTGCATCGTCGAACCTG
TCGTCGCCTGCGCCTAGTCCGGGCCTGGTTGTCGTTGCCCCTCCGTCGGGCTACTTTGTCCCGGCGCCCGGCCTC
ATTCCACCGGCCGAGCAGCATCCGGCGCTGCGGACATCAGTCTCAGCCGCCTCGGCTCGGGCCCTGGACGACAGG
AAGCGAGACTCGGGCCATGCTCCGACGGCGGCGTCGTCGGCAACAATTCACGAAGAGGACGAAGAGGACGAGGTG
CACGGTAGAGCCCAAGGCAAGCAACGGAGCTCTGGTGCCGTGCAACCGGCTGCTCATGGCGCAACAGAGCAAAGT
GGACGAGGTCTCAGATTTGCTGGCCACGCTGCCGCCTTGCCCCCGCCTGGCTCATGCTGCTCCTCTTGCTCGCCA
TCGTCGTCGCCGCCTCCATCGCCCAAGCCGTCGCTCCGGAGGCTGCTCTCCAAGCACGGCAGCCTGCACCTGACA
AGGTCAAGGTCCAGGTCGAGCCAGTCTGCCAAGGCGGCAGAAACATTAGCGCCCATGCAGCCGCAAACGCAAACG
CAAACGCCCAAGTCGCTGCTGCGGGGCCCGGCTCCCCCGCTCTCAGCCAATGGCAGCCTGCCGACTGTCGCCATG
GCCGATTCCTTGTCCCCAGCCTTTTGCCCCGACCAAGCTGCCGGCTTTTCTCCCCTGTCCATTGCCATCCCAACC
GATAACCTTATCGACGATGACTTCATGGCCGGCTTTTCCTTTTCCAAGCGCGGCAGCATCATGTTTGGCGGCCAA
CGCGCAATGCCTTCTGACGCTGACGGCGCCTCGGACGCGCTGCCCTCGTCTCTGCTCTCCATGGCACCCTTGAGC
CAAGCCCCGACAAGGACGGCCCACAGCTCGAGCGCATCCTCTCTCCCCAAGGATGCCGCTTCCACTAGCCATGGC
ACCCACCCCGCCCCACTGCCCGACTTTCGCCTGCTGCCGGCCGACGTTGAAAAGGACTCCTTAAAGGTGAGGTCG
CTGTATGCAGCTGCCGATTCTGTCAGCTGGGAAGAGGGCATGAGGCACTCGTTTTGCGAGCGCCTCGAACCCACG
CCCGAGGTCCCAGTCCAAGAGACGGACAATGACGCACGCGCTGCGCCTCTTTCGTCTGCAATAGCTATTTCAAGA
TGCGCAAGTGCCTTTTCGCATCGACCTGACAGTCTTGGTCGCGACACGACGCAGTTGGCTGGCGGTCTTGAGGAC
TGGCAAGACATCAATGGCGCCGACGTGGATCGCTATGGCTTCATCAATGCCCCTCGCCCAACATCGCGTATCAGC
ACGCCAACCGAGCTCAAGTCGTCGCAGTTTTCTCCTAGGCGGAGAAATCTCCTCCACAAGAGGGACCCCATGGGC
TTCTCGTCACAGCTTGGAGGCGGCCGCATGCCCAGCCGCAAGGTGTCGGCCCGTTCTCTCAATACCCAAAACTCG
GAAATGTCTGTTGCTTCGGGGCGCTCTGGCCGATCGGTCCTGCGCCAAGCAAGCAACCTGCTGCCCCATAACCGT
AACCGGCGCTGGATGGACGAGGCTGGTGACATGTTGACTGTCTCTCCCAGTTTGCAAGACATTGTCGAGGAGGCC
CAGGTGGAAAAGATATCCGAAGCCATCAAGCGCAAAGAGTGGGAGAGATCGGAAAAGTGGCGCAAAATGGCCAAG
GTGGTCAACCGGGGCGACGAGGACCAGGGCCAAGGCATGGAGTTCGAGTTTGATGTGCGCAACCCCAAGCTAGTT
GAGCGGACGTGGAAGGGCATCCCCGACCGGTGGCGCGCCGCTGCCTGGTGGTCCTTTCTTGCCTCGGCTGCCAAG
GAGCATCCCTCGTCGGCCTCGGTCGAGCATCTCGTGGCTGCCTTTTACGACTTGCTGGAAAAGAGCTCTCCAGAT
GACGTGCAGATTGATCTCGATGTGCCTCGCACCATTAACCGTCACATCATGTTTCGACGCCGCTACCGGGGGGGG
CAGCGTCTTCTCTTTCGCGTCCTGCACTGCTTGTCCATTTACTTTCCCGACACGGGATACGTGCAGGGCATGGCT
TCGCTAGCTGCCACACTTCTCTGCTACTTTGATGAGGAAAAGTGCTTCGTGATGCTGGTTCGCATGTGGGAGCTG
CGAGGCCTCAGCCGCCTCTACCGTCCCGGATTCGAGGGGCTCATGGCGGCCCTTGACGAGTTCAAGACGCACTGG
CTTCACGAACAGGTGGCAAACAGGCTGTCGGAGCTTTGTGTCGATACAACGGCTTACGGGACGCGCTGGTACCTG
ACGCTCTTTAATCTCTCGATTCCCTTTGCCGCTCAACTTCGCGTCTGGGACGTGTTTTTGCTGCTCGGCTCTGGT
GACGACAAGCAGGAGCAAGACATGGCCGAGGCGCAAGCCGCTCACGAGCCTGCCATCTCGCCGACTGGGCTCGAT
GTGCTGCACGCGACGGCAGCGGCTCTGATGCAGGCACTGCGAGAGGTGCTCCTCGATGCCGACTTTGAAAACGCC
ATGAAGGCACTGACGTCGTGGATATCCATCAAGGACGAAGAGCTGCTGATGAAGGTGACCAAGGCGGAGTGGAAG
ACGCACCACGGCAAGAGGAAAGCGTAG
Gene >OphauB2|2359
ATGCCGTCGAGATTTCCGTCGGTGCGTCAACCAGCGCGGCCCGGCATGGGCATGCCCAGGCCGTCTTTTCTCGAC
GACTCGAGTCTTGTGGCTCTGCGATACGAAAAAACCAAGCCAGCTGAGCCGCCCATTCCTTTGCCTCCGGCTCGC
GCGCCTCGCAGAGCATGCAGCGTGGCAAGCACGACAAAATCAGCAAGGACAGGCCAGTCTGCATCGTCGAACCTG
TCGTCGCCTGCGCCTAGTCCGGGCCTGGTTGTCGTTGCCCCTCCGTCGGGCTACTTTGTCCCGGCGCCCGGCCTC
ATTCCACCGGCCGAGCAGCATCCGGCGCTGCGGACATCAGTCTCAGCCGCCTCGGCTCGGGCCCTGGACGACAGG
AAGCGAGACTCGGGCCATGCTCCGACGGCGGCGTCGTCGGCAACAATTCACGAAGAGGACGAAGAGGACGAGGTG
CACGGTAGAGCCCAAGGCAAGCAACGGAGCTCTGGTGCCGTGCAACCGGCTGCTCATGGCGCAACAGAGCAAAGT
GGACGAGGTCTCAGATTTGCTGGCCACGCTGCCGCCTTGCCCCCGCCTGGCTCATGCTGCTCCTCTTGCTCGCCA
TCGTCGTCGCCGCCTCCATCGCCCAAGCCGTCGCTCCGGAGGCTGCTCTCCAAGCACGGCAGCCTGCACCTGACA
AGGTCAAGGTCCAGGTCGAGCCAGTCTGCCAAGGCGGCAGAAACATTAGCGCCCATGCAGCCGCAAACGCAAACG
CAAACGCCCAAGTCGCTGCTGCGGGGCCCGGCTCCCCCGCTCTCAGCCAATGGCAGCCTGCCGACTGTCGCCATG
GCCGATTCCTTGTCCCCAGCCTTTTGCCCCGACCAAGCTGCCGGCTTTTCTCCCCTGTCCATTGCCATCCCAACC
GATAACCTTATCGACGATGACTTCATGGCCGGCTTTTCCTTTTCCAAGCGCGGCAGCATCATGTTTGGCGGCCAA
CGCGCAATGCCTTCTGACGCTGACGGCGCCTCGGACGCGCTGCCCTCGTCTCTGCTCTCCATGGCACCCTTGAGC
CAAGCCCCGACAAGGACGGCCCACAGCTCGAGCGCATCCTCTCTCCCCAAGGATGCCGCTTCCACTAGCCATGGC
ACCCACCCCGCCCCACTGCCCGACTTTCGCCTGCTGCCGGCCGACGTTGAAAAGGACTCCTTAAAGGTGAGGTCG
CTGTATGCAGCTGCCGATTCTGTCAGCTGGGAAGAGGGCATGAGGCACTCGTTTTGCGAGCGCCTCGAACCCACG
CCCGAGGTCCCAGTCCAAGAGACGGACAATGACGCGTATGGATTTCCTTGAACCACCTGTTTGCCAAGTTGCTTG
CGCCTCTCTGTGCCTGGCTGCCTGCTGACCTTTGTCCCTCGTTTGCTCACAGACGCGCTGCGCCTCTTTCGTCTG
CAATAGCTATTTCAAGATGCGCAAGTGCCTTTTCGCATCGACCTGACAGTCTTGGTCGCGACACGACGCAGTTGG
CTGGCGGTCTTGAGGACTGGCAAGACATCAATGGCGCCGACGTGGATCGCTATGGCTTCATCAATGCCCCTCGCC
CAACATCGCGTATCAGCACGCCAACCGAGCTCAAGTCGTCGCAGTTTTCTCCTAGGCGGAGAAATCTCCTCCACA
AGAGGGACCCCATGGGCTTCTCGTCACAGCTTGGAGGCGGCCGCATGCCCAGCCGCAAGGTGTCGGCCCGTTCTC
TCAATACCCAAAACTCGGAAATGTCTGTTGCTTCGGGGCGCTCTGGCCGATCGGTCCTGCGCCAAGCAAGCAACC
TGCTGCCCCATAACCGTAACCGGCGCTGGATGGACGAGGCTGGTGACATGTTGACTGTCTCTCCCAGTTTGCAAG
ACATTGTCGAGGAGGCCCAGGTGGAAAAGATATCCGAAGCCATCAAGCGCAAAGAGTGGGAGAGATCGGAAAAGT
GGCGCAAAATGGCCAAGGTGGTCAACCGGGGCGACGAGGACCAGGGCCAAGGCATGGAGTTCGAGTTTGATGTGC
GCAACCCCAAGCTAGTTGAGCGGACGTGGAAGGGCATCCCCGACCGGTGGCGCGCCGCTGCCTGGTGGTCCTTTC
TTGCCTCGGCTGCCAAGGAGCATCCCTCGTCGGCCTCGGTCGAGCATCTCGTGGCTGCCTTTTACGACTTGCTGG
AAAAGAGCTCTCCAGATGACGTGCAGATTGATCTCGATGTGCCTCGCACCATTAACCGTCACATCATGTTTCGAC
GCCGCTACCGGGGGGGGCAGCGTCTTCTCTTTCGCGTCCTGCACTGCTTGTCCATTTACTTTCCCGACACGGGAT
ACGTGCAGGGCATGGCTTCGCTAGCTGCCACACTTCTCTGCTACTTTGATGAGGAAAAGTGCTTCGTGATGCTGG
TTCGCATGTGGGAGCTGCGAGGCCTCAGCCGCCTCTACCGTCCCGGATTCGAGGGGCTCATGGCGGCCCTTGACG
AGTTCAAGACGCACTGGCTTCACGAACAGGTGGCAAACAGGCTGGTGAGTTGACTGCCCCATGGTGCACGCTGTG
TGCTGACGACGACGACGAGGCTGACCGTTTTGACTCTAGTCGGAGCTTTGTGTCGATACAACGGCTTACGGGACG
CGCTGGTACCTGACGCTCTTTAATCTCTCGATTCCCTTTGCCGCTCAACTTCGCGTCTGGGACGTGTTTTTGCTG
CTCGGCTCTGGTGACGACAAGCAGGAGCAAGACATGGCCGAGGCGCAAGCCGCTCACGAGCCTGCCATCTCGCCG
ACTGGGCTCGATGTGCTGCACGCGACGGCAGCGGCTCTGATGCAGGCACTGCGAGAGGTGCTCCTCGATGCCGAC
TTTGAAAACGCCATGAAGGCACTGACGTCGTGGATATCCATCAAGGACGAAGAGCTGCTGATGAAGGTGACCAAG
GCGGAGTGGAAGACGCACCACGGCAAGAGGAAAGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail