Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2356
Gene name
LocationContig_171:40730..42195
Strand-
Gene length (bp)1465
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01946 Thi4 Thi4 family 2.1E-117 70 309
PF01266 DAO FAD dependent oxidoreductase 1.2E-07 88 131
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 4.2E-05 91 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23618|THI4_FUSOX Thiamine thiazole synthase OS=Fusarium oxysporum GN=sti35 PE=1 SV=2 17 334 0.0E+00
sp|C7Z8P6|THI4_NECH7 Thiamine thiazole synthase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_61890 PE=3 SV=1 17 336 0.0E+00
sp|P23617|THI4_FUSSH Thiamine thiazole synthase OS=Fusarium solani subsp. phaseoli GN=sti35 PE=2 SV=1 17 336 0.0E+00
sp|J9N5G7|THI4_FUSO4 Thiamine thiazole synthase OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=sti35 PE=3 SV=1 17 334 0.0E+00
sp|A7EWL8|THI4_SCLS1 Thiamine thiazole synthase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_09727 PE=3 SV=1 17 336 2.0E-178
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23618|THI4_FUSOX Thiamine thiazole synthase OS=Fusarium oxysporum GN=sti35 PE=1 SV=2 17 334 0.0E+00
sp|C7Z8P6|THI4_NECH7 Thiamine thiazole synthase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_61890 PE=3 SV=1 17 336 0.0E+00
sp|P23617|THI4_FUSSH Thiamine thiazole synthase OS=Fusarium solani subsp. phaseoli GN=sti35 PE=2 SV=1 17 336 0.0E+00
sp|J9N5G7|THI4_FUSO4 Thiamine thiazole synthase OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=sti35 PE=3 SV=1 17 334 0.0E+00
sp|A7EWL8|THI4_SCLS1 Thiamine thiazole synthase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_09727 PE=3 SV=1 17 336 2.0E-178
sp|Q9UUZ9|THI4_ASPOR Thiamine thiazole synthase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=thiA PE=3 SV=2 17 333 6.0E-173
sp|Q4WMX7|THI4_ASPFU Thiamine thiazole synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=thiA PE=3 SV=1 17 333 2.0E-171
sp|Q3V7I4|THI4_YARLI Thiamine thiazole synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=THI4 PE=3 SV=1 17 334 7.0E-171
sp|Q0UQJ9|THI4_PHANO Thiamine thiazole synthase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_05965 PE=3 SV=1 17 334 1.0E-170
sp|G5EAZ2|THI4_EMENI Thiamine thiazole synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=thiA PE=3 SV=1 17 333 1.0E-169
sp|C0NSF3|THI4_AJECG Thiamine thiazole synthase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_06083 PE=3 SV=2 17 333 1.0E-164
sp|Q1K6I4|THI4_NEUCR Thiamine thiazole synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06110 PE=1 SV=1 42 334 1.0E-160
sp|P40998|THI4_SCHPO Thiamine thiazole synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi2 PE=2 SV=2 15 334 5.0E-152
sp|Q5ANB7|THI4_CANAL Thiamine thiazole synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=THI4 PE=3 SV=1 56 334 5.0E-140
sp|C4YNP4|THI4_CANAW Thiamine thiazole synthase OS=Candida albicans (strain WO-1) GN=THI4 PE=3 SV=1 56 334 8.0E-139
sp|E3JV98|THI4_PUCGT Thiamine thiazole synthase OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_01304 PE=3 SV=1 17 325 5.0E-132
sp|Q9UVF8|THI4_UROFA Thiamine thiazole synthase OS=Uromyces fabae GN=THI2 PE=2 SV=1 36 328 3.0E-130
sp|A8NSD1|THI4_COPC7 Thiamine thiazole synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_04976 PE=3 SV=2 58 335 7.0E-130
sp|Q75F65|THI4_ASHGO Thiamine thiazole synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=THI4 PE=3 SV=1 48 327 7.0E-130
sp|P32318|THI4_YEAST Thiamine thiazole synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI4 PE=1 SV=1 46 327 1.0E-127
sp|Q38814|THI4_ARATH Thiamine thiazole synthase, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1 57 335 1.0E-121
sp|F6H7K5|THI42_VITVI Thiamine thiazole synthase 2, chloroplastic OS=Vitis vinifera GN=THI1-2 PE=3 SV=1 58 327 8.0E-120
sp|A8J9T5|THI4_CHLRE Thiamine thiazole synthase, chloroplastic OS=Chlamydomonas reinhardtii GN=THI1 PE=3 SV=1 56 328 1.0E-119
sp|F6H9A9|THI41_VITVI Thiamine thiazole synthase 1, chloroplastic OS=Vitis vinifera GN=THI1-1 PE=3 SV=1 1 325 1.0E-117
sp|A9RHX1|THI41_PHYPA Thiamine thiazole synthase 1, chloroplastic OS=Physcomitrella patens subsp. patens GN=THI1-1 PE=3 SV=1 57 335 1.0E-117
sp|A9SME1|THI42_PHYPA Thiamine thiazole synthase 2, chloroplastic OS=Physcomitrella patens subsp. patens GN=THI1-2 PE=3 SV=1 55 335 3.0E-117
sp|A9RHW6|THI43_PHYPA Thiamine thiazole synthase 3, chloroplastic OS=Physcomitrella patens subsp. patens GN=THI1-3 PE=3 SV=1 57 335 4.0E-117
sp|A9SMC8|THI44_PHYPA Thiamine thiazole synthase 4, chloroplastic OS=Physcomitrella patens subsp. patens GN=THI1-4 PE=3 SV=1 55 335 5.0E-117
sp|Q4PC85|THI4_USTMA Thiamine thiazole synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11400 PE=3 SV=2 20 335 1.0E-115
sp|O23787|THI4_CITSI Thiamine thiazole synthase, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1 57 325 2.0E-114
sp|C5X2M4|THI42_SORBI Thiamine thiazole synthase 2, chloroplastic OS=Sorghum bicolor GN=THI1-2 PE=3 SV=1 58 327 9.0E-113
sp|Q41738|THI41_MAIZE Thiamine thiazole synthase 1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1 58 327 1.0E-111
sp|C5XNN6|THI41_SORBI Thiamine thiazole synthase 1, chloroplastic OS=Sorghum bicolor GN=THI1-1 PE=3 SV=1 58 327 3.0E-111
sp|Q41739|THI42_MAIZE Thiamine thiazole synthase 2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1 58 327 6.0E-110
sp|Q38709|THI4_ALNGL Thiamine thiazole synthase, chloroplastic OS=Alnus glutinosa GN=THI1 PE=2 SV=1 58 335 5.0E-108
sp|O59082|RUBPS_PYRHO Putative ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1357 PE=3 SV=2 64 325 3.0E-43
sp|Q9V0J8|RUBPS_PYRAB Putative ribose 1,5-bisphosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB07910 PE=3 SV=1 64 325 8.0E-41
sp|Q8U0Q5|RUBPS_PYRFU Putative ribose 1,5-bisphosphate isomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1530 PE=3 SV=1 64 325 1.0E-38
sp|Q5JD25|RUBPS_THEKO Putative ribose 1,5-bisphosphate isomerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0434 PE=3 SV=1 64 325 2.0E-38
sp|Q4JAF8|RUBPS_SULAC Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0854 PE=3 SV=1 57 325 4.0E-36
sp|A8ZVP3|THI4_DESOH Putative thiazole biosynthetic enzyme OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=Dole_2426 PE=3 SV=1 64 328 6.0E-36
sp|C3NGI6|RUBPS_SULIN Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=YN1551_1140 PE=3 SV=1 60 325 1.0E-35
sp|C3MWW9|RUBPS_SULIM Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=M1425_1670 PE=3 SV=1 60 325 2.0E-35
sp|C3N749|RUBPS_SULIY Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=YG5714_1786 PE=3 SV=1 60 325 5.0E-35
sp|C3MQY1|RUBPS_SULIL Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=LS215_1798 PE=3 SV=1 60 325 5.0E-35
sp|C4KIA7|RUBPS_SULIK Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=M164_1717 PE=3 SV=1 60 325 5.0E-35
sp|C3N6N6|RUBPS_SULIA Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus islandicus (strain M.16.27) GN=M1627_1786 PE=3 SV=1 60 325 5.0E-35
sp|Q975R0|RUBPS_SULTO Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_03610 PE=3 SV=1 57 325 5.0E-34
sp|Q9WZP4|THI4_THEMA Putative thiazole biosynthetic enzyme OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0787 PE=3 SV=1 64 320 2.0E-33
sp|Q97ZY5|RUBPS_SULSO Putative ribose 1,5-bisphosphate isomerase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0436 PE=3 SV=1 60 325 2.0E-33
sp|A4YIV7|RUBPS_METS5 Putative ribose 1,5-bisphosphate isomerase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2221 PE=3 SV=1 64 331 7.0E-32
sp|O27657|RUBPS_METTH Putative ribose 1,5-bisphosphate isomerase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1620 PE=3 SV=2 68 321 8.0E-32
sp|Q9Y9Z0|RUBPS_AERPE Putative ribose 1,5-bisphosphate isomerase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_2149.1 PE=3 SV=2 61 320 2.0E-31
sp|O29556|RUBPS_ARCFU Putative ribose 1,5-bisphosphate isomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0702 PE=3 SV=1 59 321 7.0E-30
sp|Q3V7Z9|RUBPS_HALMA Putative ribose 1,5-bisphosphate isomerase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rrnAC1782 PE=3 SV=2 53 332 2.0E-28
sp|A7HMY3|THI4_FERNB Putative thiazole biosynthetic enzyme OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=Fnod_1422 PE=3 SV=1 64 328 2.0E-28
sp|Q9HMC7|RUBPS_HALSA Putative ribose 1,5-bisphosphate isomerase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_2604G PE=3 SV=1 61 320 7.0E-28
sp|B0R884|RUBPS_HALS3 Putative ribose 1,5-bisphosphate isomerase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=OE_4651F PE=3 SV=1 61 320 7.0E-28
sp|Q18KP1|RUBPS_HALWD Putative ribose 1,5-bisphosphate isomerase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=HQ_1276A PE=3 SV=1 60 325 3.0E-27
sp|A3CXS4|RUBPS_METMJ Putative ribose 1,5-bisphosphate isomerase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=Memar_2251 PE=3 SV=1 64 321 4.0E-27
sp|A0B880|RUBPS_METTP Putative ribose 1,5-bisphosphate isomerase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=Mthe_1121 PE=3 SV=2 66 325 1.0E-25
sp|Q3IMI0|RUBPS_NATPD Putative ribose 1,5-bisphosphate isomerase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=NP_5174A PE=3 SV=1 60 325 5.0E-25
sp|Q46AR1|RUBPS_METBF Putative ribose 1,5-bisphosphate isomerase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A2100 PE=3 SV=1 66 325 8.0E-24
sp|Q58018|RUBPS_METJA Putative ribose 1,5-bisphosphate isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0601 PE=1 SV=3 66 321 9.0E-23
sp|Q8TM19|RUBPS_METAC Putative ribose 1,5-bisphosphate isomerase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_2851 PE=1 SV=1 66 324 1.0E-22
sp|Q8Q0B5|RUBPS_METMA Putative ribose 1,5-bisphosphate isomerase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0222 PE=3 SV=1 66 324 2.0E-22
sp|A1RW13|RUBPS_PYRIL Putative ribose 1,5-bisphosphate isomerase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=Pisl_1998 PE=3 SV=2 66 321 2.0E-21
sp|B1YDX0|RUBPS_PYRNV Putative ribose 1,5-bisphosphate isomerase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=Tneu_1052 PE=3 SV=1 66 321 3.0E-21
sp|A4WKY7|RUBPS_PYRAR Putative ribose 1,5-bisphosphate isomerase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=Pars_1498 PE=3 SV=2 66 321 4.0E-21
sp|A3MWF6|RUBPS_PYRCJ Putative ribose 1,5-bisphosphate isomerase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=Pcal_1555 PE=3 SV=1 66 321 5.0E-21
sp|Q12U93|RUBPS_METBU Putative ribose 1,5-bisphosphate isomerase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=Mbur_2109 PE=3 SV=1 64 321 7.0E-21
sp|Q6LXJ8|RUBPS_METMP Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1352 PE=3 SV=1 66 328 8.0E-21
sp|Q8ZZM5|RUBPS_PYRAE Putative ribose 1,5-bisphosphate isomerase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE0175 PE=3 SV=1 66 325 1.0E-20
sp|C4XIR5|THI4_DESMR Putative thiazole biosynthetic enzyme OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=DMR_31420 PE=3 SV=1 64 322 2.0E-20
sp|A6UPZ7|RUBPS_METVS Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0663 PE=3 SV=1 66 325 2.0E-20
sp|A6UV59|RUBPS_META3 Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_0798 PE=3 SV=1 66 325 8.0E-18
sp|A9A9W1|RUBPS_METM6 Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=MmarC6_1321 PE=3 SV=1 93 328 1.0E-17
sp|A4FWG7|RUBPS_METM5 Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0226 PE=3 SV=1 93 328 2.0E-17
sp|A6VGT9|RUBPS_METM7 Putative ribose 1,5-bisphosphate isomerase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0597 PE=3 SV=1 93 328 6.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2356
MSALTTKTTNLSRRSIMSPPAAVSPTQPAVELAKGATVPSNMAQPSMALNDMMGKWDSFKFAPIRESQVSRAMTR
RYFEDLERYAESDIVIVGAGSCGLSTAYVLAKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPANVFLDDI
GVAYEDEGAFVVVRHAALFTSTILSKVLQLPNVKLFNATCVEDLITRPAADGGLRIAGVVTNWTLVSMHHHDQSC
MDPNTINAPLVISTTGHDGPMGAFCVKRLVSMQRVDSLGGMRGLDMQTAEDAIVKNTREVVPGLIVGGMELSELD
GANRMGPTFGAMVLSGLKAAEEALKVFEVRSKQNGY*
Coding >OphauB2|2356
ATGTCTGCCCTAACGACCAAGACGACCAACCTGTCACGCCGATCCATCATGAGCCCCCCCGCCGCCGTCTCGCCC
ACCCAGCCGGCCGTGGAGCTGGCCAAGGGAGCCACTGTGCCCTCCAACATGGCCCAGCCCAGCATGGCCCTCAAC
GACATGATGGGCAAGTGGGACAGCTTCAAGTTTGCCCCCATCCGCGAGAGCCAGGTGTCTCGCGCCATGACGCGC
CGCTACTTTGAAGACCTGGAGCGCTATGCCGAGTCGGACATTGTCATTGTCGGAGCCGGCTCGTGCGGACTCAGC
ACTGCCTATGTGCTGGCCAAGAAGCGACCTGATCTCAAGATTGCCATTATTGAGGCATCCGTGTCGCCTGGCGGC
GGGGCCTGGCTAGGAGGCCAGCTCTTCTCCGCCATGGTGATGCGCAAGCCGGCCAATGTCTTTCTTGACGACATT
GGCGTGGCCTACGAGGACGAAGGCGCCTTTGTCGTGGTGCGCCATGCCGCCCTCTTCACGTCCACCATACTGTCC
AAGGTGCTGCAGCTGCCCAACGTCAAGCTCTTCAACGCCACCTGTGTCGAGGACCTCATCACTCGCCCGGCCGCC
GACGGGGGCCTGCGCATTGCCGGCGTCGTCACCAACTGGACCCTCGTCTCCATGCACCACCACGACCAGTCGTGC
ATGGACCCCAACACCATCAACGCGCCCCTCGTCATATCCACCACGGGCCACGACGGGCCCATGGGCGCCTTCTGC
GTCAAGCGCCTCGTGAGCATGCAGCGCGTCGACAGCCTGGGCGGCATGCGCGGCCTCGACATGCAGACGGCCGAG
GATGCCATTGTCAAGAATACGCGCGAGGTGGTGCCGGGCCTCATTGTCGGCGGCATGGAGCTGTCTGAGCTTGAC
GGAGCCAACCGCATGGGGCCGACATTTGGCGCCATGGTCTTGAGCGGCCTCAAGGCGGCCGAGGAGGCGCTCAAG
GTTTTCGAGGTGCGCAGCAAGCAGAATGGCTATTGA
Transcript >OphauB2|2356
ATGTCTGCCCTAACGACCAAGACGACCAACCTGTCACGCCGATCCATCATGAGCCCCCCCGCCGCCGTCTCGCCC
ACCCAGCCGGCCGTGGAGCTGGCCAAGGGAGCCACTGTGCCCTCCAACATGGCCCAGCCCAGCATGGCCCTCAAC
GACATGATGGGCAAGTGGGACAGCTTCAAGTTTGCCCCCATCCGCGAGAGCCAGGTGTCTCGCGCCATGACGCGC
CGCTACTTTGAAGACCTGGAGCGCTATGCCGAGTCGGACATTGTCATTGTCGGAGCCGGCTCGTGCGGACTCAGC
ACTGCCTATGTGCTGGCCAAGAAGCGACCTGATCTCAAGATTGCCATTATTGAGGCATCCGTGTCGCCTGGCGGC
GGGGCCTGGCTAGGAGGCCAGCTCTTCTCCGCCATGGTGATGCGCAAGCCGGCCAATGTCTTTCTTGACGACATT
GGCGTGGCCTACGAGGACGAAGGCGCCTTTGTCGTGGTGCGCCATGCCGCCCTCTTCACGTCCACCATACTGTCC
AAGGTGCTGCAGCTGCCCAACGTCAAGCTCTTCAACGCCACCTGTGTCGAGGACCTCATCACTCGCCCGGCCGCC
GACGGGGGCCTGCGCATTGCCGGCGTCGTCACCAACTGGACCCTCGTCTCCATGCACCACCACGACCAGTCGTGC
ATGGACCCCAACACCATCAACGCGCCCCTCGTCATATCCACCACGGGCCACGACGGGCCCATGGGCGCCTTCTGC
GTCAAGCGCCTCGTGAGCATGCAGCGCGTCGACAGCCTGGGCGGCATGCGCGGCCTCGACATGCAGACGGCCGAG
GATGCCATTGTCAAGAATACGCGCGAGGTGGTGCCGGGCCTCATTGTCGGCGGCATGGAGCTGTCTGAGCTTGAC
GGAGCCAACCGCATGGGGCCGACATTTGGCGCCATGGTCTTGAGCGGCCTCAAGGCGGCCGAGGAGGCGCTCAAG
GTTTTCGAGGTGCGCAGCAAGCAGAATGGCTATTGA
Gene >OphauB2|2356
ATGTCTGCCCTAGTCCCTGCGTCTGCTCTCTTCCAACTGCCGCTTTGCCATAAAAGACTCTAGACGACCAAGACG
ACCAAGTTTGTCAAGTTTATTCATGACGACGCGTAGCCGGCTAACATGGTTTGTCCAGCCTGTCACGCCGGTACA
TTCTGTCCCGGAATCATGGCGCCTTGGCCTGGTAGCCTATCCAGACATGATCATGTCTCTTCAGGTATTGTCTGT
TGCATGAGCCGGTGCCTGTCCTTCTGCCACTGTCCCATTGTCGCCACCAAGACGGGCTTGTCCATGGGTCAGTGC
GTGGGGGGGCGTGGCTGAGATTACACGGCCATTGACTTGATCTGGATAATACCAGCGAAAGGATCATGCATTCCC
TCGAGCCCTAGCATGCTTGGTGTAGAGCCGTCCGTGGCTGACACTATCAAAGATCCATCATGAGCCCCCCCGCCG
CCGTCTCGCCCACCCAGCCGGCCGTGGAGCTGGCCAAGGGAGCCACTGTGCCCTCCAACATGGCCCAGCCCAGCA
TGGCCCTCAACGACATGATGGGCAAGTGGGACAGCTTCAAGTTTGCCCCCATCCGCGAGAGCCAGGTGTCTCGCG
CCATGACGCGCCGCTACTTTGAAGACCTGGAGCGCTATGCCGAGTCGGACATTGTCATTGTCGGAGCCGGCTCGT
GCGGACTCAGCACTGCCTATGTGCTGGCCAAGAAGCGACCTGATCTCAAGATTGCCATTATTGAGGCATCCGTGT
CGCCTGGCGGCGGGGCCTGGCTAGGAGGCCAGCTCTTCTCCGCCATGGTGATGCGCAAGCCGGCCAATGTCTTTC
TTGACGACATTGGCGTGGCCTACGAGGACGAAGGCGCCTTTGTCGTGGTGCGCCATGCCGCCCTCTTCACGTCCA
CCATACTGTCCAAGGTGCTGCAGCTGCCCAACGTCAAGCTCTTCAACGCCACCTGTGTCGAGGACCTCATCACTC
GCCCGGCCGCCGACGGGGGCCTGCGCATTGCCGGCGTCGTCACCAACTGGACCCTCGTCTCCATGCACCACCACG
ACCAGTCGTGCATGGACCCCAACACCATCAACGCGCCCCTCGTCATATCCACCACGGGCCACGACGGGCCCATGG
GCGCCTTCTGCGTCAAGCGCCTCGTGAGCATGCAGCGCGTCGACAGCCTGGGCGGCATGCGCGGCCTCGACATGC
AGACGGCCGAGGATGCCATTGTCAAGAATACGCGCGAGGTGGTGCCGGGCCTCATTGTCGGCGGCATGGAGCTGT
CTGAGCTTGACGGAGCCAACCGCATGGGTAAGTGGCGTCTTAGGCCCCCTCCCCCCCGGTGTCTGGCTGCGCGTG
GCTGACGCCGACCTTTGCAGGGCCGACATTTGGCGCCATGGTCTTGAGCGGCCTCAAGGCGGCCGAGGAGGCGCT
CAAGGTTTTCGAGGTGCGCAGCAAGCAGAATGGCTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail