Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2355
Gene name
LocationContig_171:37220..40571
Strand+
Gene length (bp)3351
Transcript length (bp)3087
Coding sequence length (bp)3087
Protein length (aa) 1029

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06032 DUF917 Protein of unknown function (DUF917) 2.1E-120 638 1008
PF05378 Hydant_A_N Hydantoinase/oxoprolinase N-terminal region 3.0E-25 5 181
PF01968 Hydantoinase_A Hydantoinase/oxoprolinase 1.8E-22 205 477

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01262|HYUA_PSESN Hydantoin utilization protein A OS=Pseudomonas sp. (strain NS671) GN=hyuA PE=3 SV=1 1 362 5.0E-15
sp|Q5P5G4|APCC_AROAE Acetophenone carboxylase gamma subunit OS=Aromatoleum aromaticum (strain EbN1) GN=apc3 PE=1 SV=1 6 415 4.0E-09

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2355
MSLYRIGVDVGGTNTDAALLDIAASDRPDRGVLATHKATTTADLTSGIQSAVAAVVQAAGVDASRILSVTIGTTH
FINALLEADARRLDRVAVVRLCGPFTRQLPPFSGFPPRLQTLLDGGVYYLDGGLEMDGRQIAALDAAQVRRTARA
IVAAGVEAVALVGVFSPLDHAGLHEQRCKHLMQLDAPQLRLVCSRDIGPVGLLERENATILNAAILRTGRRVKAS
LQAAMARLDLRCQLFLSQNDGSLVDADIAADFPIKTFASGPTNSTTGAAFLAGFPRPAPEGPEPQVLVVDIGGTT
TDVCALLPSAFPRQAPTYVELAGVRTAFSMPHVVSIGLGGGSLVDLDPAHATAAVGPASVGHLLSQQARVFGGPT
LTATDIVVAAGHASLGDARLVADLPPSSVAAAQEAIHKKLEGLIDKMRVSQAPVHVLLVGGGALLASQPLARVDR
CIRPVHAEAANAVGAAIAKVSGQVDLLQVLDDKTTEAVVVAQACQRAIDLAVEKGAARDDVAIVEVNKTPLQYMA
QLTLRIQVRAVGRLAVPFARSEAPAQAPPSRQEGAEQEGREHEHEHEGAQKEQEEGREHEQEQEGAQKEQEEARE
QEAREHEAREHEHHSLNLDLALYRPNVRDGIWHLSELDLALMATGCGVLGTGGGGPTYYEYLKCLHLMRRGCSMR
IVSPKALADDAVVCMGAWYGSPSVINERISAGGEIIDAIKAVNRIKGLSKFDALFSDEIGGGNGLSALPTSVHFD
VPVVDGDAMGRAFPTMYHIIFSVYGYPLEPCSITDGAGNVSVVMNTDSPLRLERLMRASAIELGLACASSSNPLT
GAIVKAYGVPNTLSQAWYLGRAVHLARRNKTSYVDAIFDVCAGKLLYTGKIVQVERYIGGGYTLGTVVIAPLSAD
ELEAPGNQAGSKAKLEPIQGRHMVIPFQNEYLYAAYSDATGSEPSRQVVCTVPHLISILGHDGEAIGSQELRYGL
RVNVIALPAHPLWRSERGLKVGGPAGFGLDMDEVGVDNDFVEAPSVIDEFGRL*
Coding >OphauB2|2355
ATGTCGCTATACCGCATCGGAGTCGACGTTGGCGGGACCAACACAGACGCGGCCTTGCTCGACATTGCCGCCAGT
GACAGGCCAGACCGCGGCGTGCTGGCAACGCACAAGGCAACCACCACGGCGGACCTGACGAGCGGCATTCAGAGC
GCCGTGGCTGCCGTTGTCCAGGCGGCTGGCGTGGACGCGTCGCGCATCCTCAGCGTCACCATTGGCACCACGCAC
TTCATCAACGCCCTGCTCGAGGCCGATGCGCGCCGCCTGGACCGCGTTGCCGTGGTGCGCCTCTGCGGCCCCTTT
ACGCGCCAGCTGCCGCCCTTTTCCGGCTTCCCGCCCCGTCTACAGACTCTGCTCGACGGCGGCGTCTACTACCTC
GACGGCGGCCTCGAGATGGACGGCCGCCAAATCGCCGCCCTCGATGCCGCCCAGGTGCGCCGCACAGCCCGCGCC
ATTGTGGCGGCTGGCGTCGAGGCCGTGGCCCTCGTCGGCGTCTTCTCGCCCCTCGACCACGCCGGCCTGCACGAG
CAGCGTTGCAAGCACCTCATGCAGCTTGACGCGCCCCAGCTGCGCCTCGTCTGCTCCCGCGACATTGGCCCTGTT
GGCCTGCTGGAGCGCGAAAACGCCACCATCCTCAACGCCGCCATTCTCAGGACCGGCCGCCGCGTCAAGGCCAGC
CTGCAGGCCGCCATGGCTCGCCTCGATCTGCGCTGCCAGCTCTTCCTCTCCCAAAACGACGGCAGCCTCGTCGAC
GCCGACATCGCCGCCGACTTCCCCATCAAGACCTTTGCCAGCGGGCCCACCAATAGCACCACGGGCGCTGCCTTT
CTCGCCGGCTTCCCCCGTCCCGCCCCCGAGGGCCCCGAGCCACAGGTGCTCGTCGTCGACATTGGCGGCACCACC
ACAGACGTCTGTGCCCTGCTTCCCTCGGCCTTTCCCCGCCAGGCCCCCACCTACGTCGAGCTGGCCGGCGTCCGC
ACCGCCTTTTCCATGCCTCACGTCGTCTCCATTGGCCTTGGCGGCGGCAGCCTCGTTGACCTTGACCCAGCCCAC
GCCACCGCTGCCGTTGGCCCCGCCTCGGTCGGCCATCTCCTGAGCCAGCAGGCCCGAGTCTTTGGCGGCCCCACG
CTGACTGCCACCGACATTGTCGTTGCCGCCGGCCACGCCTCGCTGGGAGACGCCCGCCTCGTCGCCGACTTGCCC
CCATCTAGTGTAGCCGCAGCCCAAGAGGCTATCCACAAGAAGCTCGAGGGCCTCATTGACAAGATGCGCGTCTCG
CAGGCTCCCGTCCACGTCTTGCTCGTTGGCGGCGGTGCCCTGCTCGCCAGCCAGCCGCTGGCACGAGTCGACCGC
TGCATCCGCCCCGTGCACGCCGAAGCCGCAAATGCCGTCGGCGCCGCCATTGCCAAAGTGTCGGGCCAGGTCGAC
TTGCTCCAGGTTCTCGACGACAAGACGACCGAGGCTGTCGTGGTGGCCCAAGCCTGCCAGCGCGCCATTGACCTG
GCCGTGGAAAAGGGGGCTGCTCGCGACGACGTGGCCATTGTCGAGGTGAACAAGACGCCGCTGCAGTACATGGCG
CAGTTGACCTTGCGCATCCAGGTGCGTGCCGTGGGGAGGCTGGCCGTGCCGTTTGCCAGGAGCGAGGCACCAGCC
CAGGCACCGCCCTCGAGGCAAGAGGGAGCAGAGCAAGAGGGACGAGAGCACGAGCACGAGCACGAGGGAGCGCAA
AAGGAGCAAGAAGAGGGACGAGAGCACGAGCAGGAGCAAGAGGGAGCGCAAAAGGAGCAAGAAGAGGCACGAGAG
CAAGAGGCACGAGAGCACGAGGCACGAGAGCACGAGCACCACTCCCTCAACCTCGACCTCGCCCTCTATCGCCCC
AACGTCCGCGACGGCATCTGGCACCTGTCGGAGCTCGACCTCGCCCTCATGGCTACCGGCTGCGGCGTCTTGGGA
ACGGGCGGCGGCGGCCCAACCTACTACGAATACCTCAAGTGTCTGCACCTGATGCGCCGCGGCTGCAGCATGCGA
ATCGTGTCGCCCAAGGCCCTGGCCGACGATGCCGTGGTGTGCATGGGGGCCTGGTACGGCAGCCCCAGCGTCATC
AACGAGCGCATCTCGGCCGGCGGCGAAATCATTGACGCCATCAAGGCCGTCAACCGCATCAAGGGCCTGTCCAAG
TTTGATGCCCTCTTTTCCGACGAAATTGGCGGCGGCAACGGCCTCAGCGCCCTTCCCACCTCGGTCCACTTTGAC
GTGCCCGTCGTCGACGGCGACGCCATGGGCAGGGCCTTTCCCACCATGTACCACATCATATTCAGCGTCTACGGC
TATCCGCTCGAGCCCTGCTCCATCACGGATGGTGCCGGCAACGTTTCCGTCGTCATGAACACCGACAGTCCGCTC
CGCCTCGAGCGCCTGATGCGCGCCTCGGCCATTGAGCTGGGGCTGGCCTGTGCCTCGAGCTCCAATCCCCTGACG
GGCGCCATTGTCAAGGCCTATGGCGTGCCAAACACGCTCTCGCAGGCCTGGTACCTGGGCCGCGCCGTCCATTTG
GCCCGCCGCAACAAGACGAGCTACGTTGATGCCATTTTTGATGTTTGTGCCGGCAAGTTGCTCTACACAGGCAAG
ATTGTCCAGGTAGAGCGTTATATCGGAGGCGGCTACACCCTCGGCACCGTTGTCATTGCGCCCCTGAGTGCAGAC
GAGCTCGAGGCTCCCGGCAACCAAGCCGGCAGCAAGGCCAAGCTCGAGCCCATCCAGGGTCGCCACATGGTGATT
CCCTTTCAAAACGAGTATCTCTACGCCGCCTACAGCGATGCTACGGGATCCGAGCCATCACGACAAGTCGTCTGC
ACCGTGCCACACCTCATATCCATCCTCGGCCACGACGGAGAGGCCATTGGGTCACAGGAGCTGCGCTACGGGCTC
CGCGTCAATGTCATTGCTCTGCCCGCCCATCCTCTGTGGCGAAGTGAGAGAGGGCTCAAGGTTGGCGGCCCCGCG
GGCTTTGGGCTCGACATGGACGAGGTTGGGGTGGACAATGACTTTGTCGAGGCACCAAGCGTCATTGATGAGTTT
GGCCGCCTCTAA
Transcript >OphauB2|2355
ATGTCGCTATACCGCATCGGAGTCGACGTTGGCGGGACCAACACAGACGCGGCCTTGCTCGACATTGCCGCCAGT
GACAGGCCAGACCGCGGCGTGCTGGCAACGCACAAGGCAACCACCACGGCGGACCTGACGAGCGGCATTCAGAGC
GCCGTGGCTGCCGTTGTCCAGGCGGCTGGCGTGGACGCGTCGCGCATCCTCAGCGTCACCATTGGCACCACGCAC
TTCATCAACGCCCTGCTCGAGGCCGATGCGCGCCGCCTGGACCGCGTTGCCGTGGTGCGCCTCTGCGGCCCCTTT
ACGCGCCAGCTGCCGCCCTTTTCCGGCTTCCCGCCCCGTCTACAGACTCTGCTCGACGGCGGCGTCTACTACCTC
GACGGCGGCCTCGAGATGGACGGCCGCCAAATCGCCGCCCTCGATGCCGCCCAGGTGCGCCGCACAGCCCGCGCC
ATTGTGGCGGCTGGCGTCGAGGCCGTGGCCCTCGTCGGCGTCTTCTCGCCCCTCGACCACGCCGGCCTGCACGAG
CAGCGTTGCAAGCACCTCATGCAGCTTGACGCGCCCCAGCTGCGCCTCGTCTGCTCCCGCGACATTGGCCCTGTT
GGCCTGCTGGAGCGCGAAAACGCCACCATCCTCAACGCCGCCATTCTCAGGACCGGCCGCCGCGTCAAGGCCAGC
CTGCAGGCCGCCATGGCTCGCCTCGATCTGCGCTGCCAGCTCTTCCTCTCCCAAAACGACGGCAGCCTCGTCGAC
GCCGACATCGCCGCCGACTTCCCCATCAAGACCTTTGCCAGCGGGCCCACCAATAGCACCACGGGCGCTGCCTTT
CTCGCCGGCTTCCCCCGTCCCGCCCCCGAGGGCCCCGAGCCACAGGTGCTCGTCGTCGACATTGGCGGCACCACC
ACAGACGTCTGTGCCCTGCTTCCCTCGGCCTTTCCCCGCCAGGCCCCCACCTACGTCGAGCTGGCCGGCGTCCGC
ACCGCCTTTTCCATGCCTCACGTCGTCTCCATTGGCCTTGGCGGCGGCAGCCTCGTTGACCTTGACCCAGCCCAC
GCCACCGCTGCCGTTGGCCCCGCCTCGGTCGGCCATCTCCTGAGCCAGCAGGCCCGAGTCTTTGGCGGCCCCACG
CTGACTGCCACCGACATTGTCGTTGCCGCCGGCCACGCCTCGCTGGGAGACGCCCGCCTCGTCGCCGACTTGCCC
CCATCTAGTGTAGCCGCAGCCCAAGAGGCTATCCACAAGAAGCTCGAGGGCCTCATTGACAAGATGCGCGTCTCG
CAGGCTCCCGTCCACGTCTTGCTCGTTGGCGGCGGTGCCCTGCTCGCCAGCCAGCCGCTGGCACGAGTCGACCGC
TGCATCCGCCCCGTGCACGCCGAAGCCGCAAATGCCGTCGGCGCCGCCATTGCCAAAGTGTCGGGCCAGGTCGAC
TTGCTCCAGGTTCTCGACGACAAGACGACCGAGGCTGTCGTGGTGGCCCAAGCCTGCCAGCGCGCCATTGACCTG
GCCGTGGAAAAGGGGGCTGCTCGCGACGACGTGGCCATTGTCGAGGTGAACAAGACGCCGCTGCAGTACATGGCG
CAGTTGACCTTGCGCATCCAGGTGCGTGCCGTGGGGAGGCTGGCCGTGCCGTTTGCCAGGAGCGAGGCACCAGCC
CAGGCACCGCCCTCGAGGCAAGAGGGAGCAGAGCAAGAGGGACGAGAGCACGAGCACGAGCACGAGGGAGCGCAA
AAGGAGCAAGAAGAGGGACGAGAGCACGAGCAGGAGCAAGAGGGAGCGCAAAAGGAGCAAGAAGAGGCACGAGAG
CAAGAGGCACGAGAGCACGAGGCACGAGAGCACGAGCACCACTCCCTCAACCTCGACCTCGCCCTCTATCGCCCC
AACGTCCGCGACGGCATCTGGCACCTGTCGGAGCTCGACCTCGCCCTCATGGCTACCGGCTGCGGCGTCTTGGGA
ACGGGCGGCGGCGGCCCAACCTACTACGAATACCTCAAGTGTCTGCACCTGATGCGCCGCGGCTGCAGCATGCGA
ATCGTGTCGCCCAAGGCCCTGGCCGACGATGCCGTGGTGTGCATGGGGGCCTGGTACGGCAGCCCCAGCGTCATC
AACGAGCGCATCTCGGCCGGCGGCGAAATCATTGACGCCATCAAGGCCGTCAACCGCATCAAGGGCCTGTCCAAG
TTTGATGCCCTCTTTTCCGACGAAATTGGCGGCGGCAACGGCCTCAGCGCCCTTCCCACCTCGGTCCACTTTGAC
GTGCCCGTCGTCGACGGCGACGCCATGGGCAGGGCCTTTCCCACCATGTACCACATCATATTCAGCGTCTACGGC
TATCCGCTCGAGCCCTGCTCCATCACGGATGGTGCCGGCAACGTTTCCGTCGTCATGAACACCGACAGTCCGCTC
CGCCTCGAGCGCCTGATGCGCGCCTCGGCCATTGAGCTGGGGCTGGCCTGTGCCTCGAGCTCCAATCCCCTGACG
GGCGCCATTGTCAAGGCCTATGGCGTGCCAAACACGCTCTCGCAGGCCTGGTACCTGGGCCGCGCCGTCCATTTG
GCCCGCCGCAACAAGACGAGCTACGTTGATGCCATTTTTGATGTTTGTGCCGGCAAGTTGCTCTACACAGGCAAG
ATTGTCCAGGTAGAGCGTTATATCGGAGGCGGCTACACCCTCGGCACCGTTGTCATTGCGCCCCTGAGTGCAGAC
GAGCTCGAGGCTCCCGGCAACCAAGCCGGCAGCAAGGCCAAGCTCGAGCCCATCCAGGGTCGCCACATGGTGATT
CCCTTTCAAAACGAGTATCTCTACGCCGCCTACAGCGATGCTACGGGATCCGAGCCATCACGACAAGTCGTCTGC
ACCGTGCCACACCTCATATCCATCCTCGGCCACGACGGAGAGGCCATTGGGTCACAGGAGCTGCGCTACGGGCTC
CGCGTCAATGTCATTGCTCTGCCCGCCCATCCTCTGTGGCGAAGTGAGAGAGGGCTCAAGGTTGGCGGCCCCGCG
GGCTTTGGGCTCGACATGGACGAGGTTGGGGTGGACAATGACTTTGTCGAGGCACCAAGCGTCATTGATGAGTTT
GGCCGCCTCTAA
Gene >OphauB2|2355
ATGTCGCTATACCGCATCGGAGTCGACGTTGGCGGGACCAACACAGACGCGGCCTTGCTCGACATTGCCGCCAGT
GACAGGCCAGACCGCGGCGTGCTGGCAACGCACAAGGCAACCACCACGGCGGACCTGACGAGCGGCATTCAGAGC
GCCGTGGCTGCCGTTGTCCAGGCGGCTGGCGTGGACGCGTCGCGCATCCTCAGCGTCACCATTGGCACCACGCAC
TTCATCAACGCCCTGCTCGAGGCCGATGCGCGCCGCCTGGACCGCGTTGCCGTGGTGCGCCTCTGCGGCCCCTTT
ACGCGCCAGCTGCCGCCCTTTTCCGGCTTCCCGCCCCGTCTACAGACTCTGCTCGACGGCGGCGTCTACTACCTC
GACGGCGGCCTCGAGATGGACGGCCGCCAAATCGCCGCCCTCGATGCCGCCCAGGTGCGCCGCACAGCCCGCGCC
ATTGTGGCGGCTGGCGTCGAGGCCGTGGCCCTCGTCGGCGTCTTCTCGCCCCTCGACCACGCCGGCCTGCACGAG
CAGCGTTGCAAGCACCTCATGCAGCTTGACGCGCCCCAGCTGCGCCTCGTCTGCTCCCGCGACATTGGCCCTGTT
GGCCTGCTGGAGCGCGAAAACGCCACCATCCTCAACGCCGCCATTCTCAGGACCGGCCGCCGCGTCAAGGCCAGC
CTGCAGGCCGCCATGGCTCGCCTCGATCTGCGCTGCCAGCTCTTCCTCTCCCAAAACGACGGCAGCCTCGTCGAC
GCCGACATCGCCGCCGACTTCCCCATCAAGACCTTTGCCAGCGGGCCCACCAATAGCACCACGGGCGCTGCCTTT
CTCGCCGGCTTCCCCCGTCCCGCCCCCGAGGGCCCCGAGCCACAGGTGCTCGTCGTCGACATTGGCGGCACCACC
ACAGACGTCTGTGCCCTGCTTCCCTCGGCCTTTCCCCGCCAGGCCCCCACCTACGTCGAGCTGGCCGGCGTCCGC
ACCGCCTTTTCCATGCCTCACGTCGTCTCCATTGGCCTTGGCGGCGGCAGCCTCGTTGACCTTGACCCAGCCCAC
GCCACCGCTGCCGTTGGCCCCGCCTCGGTCGGCCATCTCCTGAGCCAGCAGGCCCGAGTCTTTGGCGGCCCCACG
CTGACTGCCACCGACATTGTCGTTGCCGCCGGCCACGCCTCGCTGGGAGACGCCCGCCTCGTCGCCGACTTGCCC
CCATCTAGTGTAGCCGCAGCCCAAGAGGCTATCCACAAGAAGCTCGAGGGCCTCATTGACAAGATGCGCGTCTCG
CAGGCTCCCGTCCACGTCTTGCTCGTTGGCGGCGGTGCCCTGCTCGCCAGCCAGCCGCTGGCACGAGTCGACCGC
TGCATCCGCCCCGTGCACGCCGAAGCCGCAAATGCCGTCGGCGCCGCCATTGCCAAAGTGTCGGGCCAGGTCGAC
TTGCTCCAGGTTCTCGACGACAAGACGACCGAGGCTGTCGTGGTGGCCCAAGCCTGCCAGCGCGCCATTGACCTG
GCCGTGGAAAAGGGGGCTGCTCGCGACGACGTGGCCATTGTCGAGGTGAACAAGACGCCGCTGCAGTACATGGCG
CAGTTGACCTTGCGCATCCAGGTGCGTGCCGTGGGGAGGCTGGCCGTGCCGTTTGCCAGGAGCGAGGCACCAGCC
CAGGCACCGCCCTCGAGGCAAGAGGGAGCAGAGCAAGAGGGACGAGAGCACGAGCACGAGCACGAGGGAGCGCAA
AAGGAGCAAGAAGAGGGACGAGAGCACGAGCAGGAGCAAGAGGGAGCGCAAAAGGAGCAAGAAGAGGCACGAGAG
CAAGAGGCACGAGAGCACGAGGCACGAGAGCACGAGCACCACTCCCTCAACCTCGACCTCGCCCTCTATCGCCCC
AACGTCCGCGACGGCATCTGGCACCTGTCGGAGCTCGACCTCGCCCTCATGGCTACCGGCTGCGGCGTCTTGGGA
ACGGGCGGCGGCGGCCCAACCTACTACGAATACCTCAAGTGTCTGCACCTGATGCGCCGCGGCTGCAGCATGCGA
ATCGTGTCGCCCAAGGCCCTGGCCGACGATGCCGTGGTGTGCATGGGGGCCTGGTACGGCAGCCCCAGCGTCATC
AACGAGCGCATCTCGGCCGGCGGCGAAATCATTGACGCCATCAAGGCCGTCAACCGCATCAAGGGCCTGTCCAAG
TTTGATGCCCTCTTTTCCGACGAAATGTAAGTCGAGTGGCTGCAGCCGCGTCTTCCTCTTGCGCCGCCAGCTCAC
CAGGTCTCGAGTGGCGGCGGCAACGGCCTCAGCGCCCTTCCCACCTCGGTCCACTTTGACGTGCCCGTCGTCGAC
GGCGACGCCATGGGCAGGGCCTTTCCCACCATGTACCACAGTGTGTTTGCCCACCCCGCCGCCGCCCAGCAGCCG
CTGACGCTGCCCTGACTAGTCATATTCAGCGTCTACGGCTATCCGCTCGAGCCCTGCTCCATCACGGATGGTGCC
GGCAACGTTTCCGTCGTCATGGCAAGTCTCTGATGGCCTGTTCCGCCCCTGAAGCCCATGACCAACCACCTGTCT
AGAACACCGACAGTCCGCTCCGCCTCGAGCGCCTGATGCGCGCCTCGGCCATTGAGCTGGGGCTGGCCTGTGCCT
CGAGCTCCAATCCCCTGACGGGCGCCATTGTCAAGGCCTATGGCGTGCCAAACACGCTCTCGCAGGCCTGGTACC
TGGGCCGCGCCGTCCATTTGGCCCGCCGCAACAAGACGAGCTACGTTGATGCCATTGTAAGCCCCCGCTCCCCCC
CTGCCTCTGTCTCTGCCTCTGCCTCTGCCCTCGGCGCCTCGAGACTTGCTGCTGATGCCAGACGCGCCCCCCAAG
TTTGATGTTTGTGCCGGCAAGTTGCTCTACACAGGCAAGATTGTCCAGGTAGAGCGTTATATCGGAGGCGGCTAC
ACCCTCGGCACCGTTGTCATTGCGCCCCTGAGTGCAGACGAGCTCGAGGCTCCCGGCAACCAAGCCGGCAGCAAG
GCCAAGCTCGAGCCCATCCAGGGTCGCCACATGGTGATTCCCTTTCAAAACGAGTATCTCTACGCCGCCTACAGC
GATGCTACGGGATCCGAGCCATCACGACAAGTCGTCTGCACCGTGCCACACCTCATATCCATCCTCGGCCACGAC
GGAGAGGCCATTGGGTCACAGGAGCTGCGCTACGGGCTCCGCGTCAATGTCATTGCTCTGCCCGCCCATCCTCTG
TGGCGAAGTGAGAGAGGGCTCAAGGTTGGCGGCCCCGCGGGCTTTGGGCTCGACATGGACGAGGTTGGGGTGGAC
AATGACTTTGTCGAGGCACCAAGCGTCATTGATGAGTTTGGCCGCCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail