Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2350
Gene name
LocationContig_171:27853..29410
Strand+
Gene length (bp)1557
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00266 Aminotran_5 Aminotransferase class-V 4.5E-20 94 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7UX13|EGT2_NEUCR Hercynylcysteine sulfoxide lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=egt-2 PE=1 SV=1 39 472 8.0E-164
sp|O94431|EGT2_SCHPO Hercynylcysteine sulfoxide lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=egt2 PE=3 SV=1 39 463 1.0E-52
sp|Q3E6S9|CNIF3_ARATH Probable L-cysteine desulfhydrase, chloroplastic OS=Arabidopsis thaliana GN=CpNIFS3 PE=1 SV=1 50 392 3.0E-34
sp|Q9M1R1|LCYD1_ARATH L-cysteine desulfhydrase OS=Arabidopsis thaliana GN=LCD PE=2 SV=1 56 465 2.0E-29
sp|Q9LGZ2|LCYD1_ORYSJ Putative L-cysteine desulfhydrase 1 OS=Oryza sativa subsp. japonica GN=Os01g0290100 PE=2 SV=1 56 454 5.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7UX13|EGT2_NEUCR Hercynylcysteine sulfoxide lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=egt-2 PE=1 SV=1 39 472 8.0E-164
sp|O94431|EGT2_SCHPO Hercynylcysteine sulfoxide lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=egt2 PE=3 SV=1 39 463 1.0E-52
sp|Q3E6S9|CNIF3_ARATH Probable L-cysteine desulfhydrase, chloroplastic OS=Arabidopsis thaliana GN=CpNIFS3 PE=1 SV=1 50 392 3.0E-34
sp|Q9M1R1|LCYD1_ARATH L-cysteine desulfhydrase OS=Arabidopsis thaliana GN=LCD PE=2 SV=1 56 465 2.0E-29
sp|Q9LGZ2|LCYD1_ORYSJ Putative L-cysteine desulfhydrase 1 OS=Oryza sativa subsp. japonica GN=Os01g0290100 PE=2 SV=1 56 454 5.0E-29
sp|P18549|CEFD_STRC2 Isopenicillin N epimerase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=cefD PE=1 SV=3 49 379 2.0E-22
sp|Q03046|CEFD_AMYLA Isopenicillin N epimerase OS=Amycolatopsis lactamdurans GN=cefD PE=3 SV=1 44 336 3.0E-22
sp|Q5JNT6|LCYD2_ORYSJ Putative L-cysteine desulfhydrase 2 OS=Oryza sativa subsp. japonica GN=Os01g0290600 PE=3 SV=1 56 346 1.0E-18
sp|B4EZU8|ISCS_PROMH Cysteine desulfurase IscS OS=Proteus mirabilis (strain HI4320) GN=iscS PE=3 SV=1 95 273 3.0E-09
sp|Q9KPQ7|CSD_VIBCH Probable cysteine desulfurase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=csd PE=3 SV=1 65 364 6.0E-09
sp|Q92HP1|ISCS_RICCN Cysteine desulfurase IscS OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=iscS PE=3 SV=1 95 294 7.0E-09
sp|A8GSG4|ISCS_RICRS Cysteine desulfurase IscS OS=Rickettsia rickettsii (strain Sheila Smith) GN=iscS PE=3 SV=1 95 294 7.0E-09
sp|B0BXX6|ISCS_RICRO Cysteine desulfurase IscS OS=Rickettsia rickettsii (strain Iowa) GN=iscS PE=3 SV=1 95 294 7.0E-09
sp|C3PNQ8|ISCS_RICAE Cysteine desulfurase IscS OS=Rickettsia africae (strain ESF-5) GN=iscS PE=3 SV=1 95 294 8.0E-09
sp|C4K1Z7|ISCS_RICPU Cysteine desulfurase IscS OS=Rickettsia peacockii (strain Rustic) GN=iscS PE=3 SV=1 95 294 8.0E-09
sp|A1S544|ISCS_SHEAM Cysteine desulfurase IscS OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=iscS PE=3 SV=1 95 273 1.0E-08
sp|Q8EEU9|ISCS_SHEON Cysteine desulfurase IscS OS=Shewanella oneidensis (strain MR-1) GN=iscS PE=3 SV=1 95 273 1.0E-08
sp|A1RJ52|ISCS_SHESW Cysteine desulfurase IscS OS=Shewanella sp. (strain W3-18-1) GN=iscS PE=3 SV=1 95 273 2.0E-08
sp|A4Y7D7|ISCS_SHEPC Cysteine desulfurase IscS OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=iscS PE=3 SV=1 95 273 2.0E-08
sp|Q7N224|ISCS_PHOLL Cysteine desulfurase IscS OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=iscS PE=3 SV=1 95 273 2.0E-08
sp|A8GHY3|ISCS_SERP5 Cysteine desulfurase IscS OS=Serratia proteamaculans (strain 568) GN=iscS PE=3 SV=1 95 273 2.0E-08
sp|C6DBJ1|ISCS_PECCP Cysteine desulfurase IscS OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=iscS PE=3 SV=1 95 273 2.0E-08
sp|Q0HJF4|ISCS_SHESM Cysteine desulfurase IscS OS=Shewanella sp. (strain MR-4) GN=iscS PE=3 SV=1 95 273 3.0E-08
sp|A8F204|ISCS_RICM5 Cysteine desulfurase IscS OS=Rickettsia massiliae (strain Mtu5) GN=iscS PE=3 SV=1 95 294 3.0E-08
sp|B8E9D2|ISCS_SHEB2 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS223) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|P0A6C0|ISCS_SHIFL Cysteine desulfurase IscS OS=Shigella flexneri GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|Q0T1Y9|ISCS_SHIF8 Cysteine desulfurase IscS OS=Shigella flexneri serotype 5b (strain 8401) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B2TXV5|ISCS_SHIB3 Cysteine desulfurase IscS OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B1LNI6|ISCS_ECOSM Cysteine desulfurase IscS OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B6I5A2|ISCS_ECOSE Cysteine desulfurase IscS OS=Escherichia coli (strain SE11) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B7N6B7|ISCS_ECOLU Cysteine desulfurase IscS OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|P0A6B7|ISCS_ECOLI Cysteine desulfurase IscS OS=Escherichia coli (strain K12) GN=iscS PE=1 SV=1 95 273 4.0E-08
sp|B1IWD1|ISCS_ECOLC Cysteine desulfurase IscS OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|P0A6B8|ISCS_ECOL6 Cysteine desulfurase IscS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|Q0TEV5|ISCS_ECOL5 Cysteine desulfurase IscS OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|A8A336|ISCS_ECOHS Cysteine desulfurase IscS OS=Escherichia coli O9:H4 (strain HS) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B1XB05|ISCS_ECODH Cysteine desulfurase IscS OS=Escherichia coli (strain K12 / DH10B) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|C4ZXA5|ISCS_ECOBW Cysteine desulfurase IscS OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B7M7N3|ISCS_ECO8A Cysteine desulfurase IscS OS=Escherichia coli O8 (strain IAI1) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B7MYG3|ISCS_ECO81 Cysteine desulfurase IscS OS=Escherichia coli O81 (strain ED1a) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B7NRH9|ISCS_ECO7I Cysteine desulfurase IscS OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B5Z104|ISCS_ECO5E Cysteine desulfurase IscS OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|P0A6B9|ISCS_ECO57 Cysteine desulfurase IscS OS=Escherichia coli O157:H7 GN=iscS PE=1 SV=1 95 273 4.0E-08
sp|B7LDC2|ISCS_ECO55 Cysteine desulfurase IscS OS=Escherichia coli (strain 55989 / EAEC) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B7MIM0|ISCS_ECO45 Cysteine desulfurase IscS OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B7UGX6|ISCS_ECO27 Cysteine desulfurase IscS OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|A7ZPX4|ISCS_ECO24 Cysteine desulfurase IscS OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|B7LKA9|ISCS_ESCF3 Cysteine desulfurase IscS OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|A7MGX8|ISCS_CROS8 Cysteine desulfurase IscS OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|A3D577|ISCS_SHEB5 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|A0KJ32|ISCS_AERHH Cysteine desulfurase IscS OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=iscS PE=3 SV=1 95 273 4.0E-08
sp|A9L3R0|ISCS_SHEB9 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS195) GN=iscS PE=3 SV=1 95 273 5.0E-08
sp|A6WNY5|ISCS_SHEB8 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS185) GN=iscS PE=3 SV=1 95 273 5.0E-08
sp|C6DKM6|SUFS_PECCP Cysteine desulfurase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=sufS PE=3 SV=1 95 272 5.0E-08
sp|Q4UL77|ISCS_RICFE Cysteine desulfurase IscS OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=iscS PE=3 SV=2 95 294 5.0E-08
sp|Q0HVP4|ISCS_SHESR Cysteine desulfurase IscS OS=Shewanella sp. (strain MR-7) GN=iscS PE=3 SV=1 95 273 5.0E-08
sp|A0KXJ0|ISCS_SHESA Cysteine desulfurase IscS OS=Shewanella sp. (strain ANA-3) GN=iscS PE=3 SV=1 95 273 5.0E-08
sp|Q080P6|ISCS_SHEFN Cysteine desulfurase IscS OS=Shewanella frigidimarina (strain NCIMB 400) GN=iscS PE=3 SV=1 95 273 6.0E-08
sp|Q6D625|SUFS_PECAS Cysteine desulfurase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=sufS PE=3 SV=1 95 272 6.0E-08
sp|A6TCF1|ISCS_KLEP7 Cysteine desulfurase IscS OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=iscS PE=3 SV=1 95 273 7.0E-08
sp|Q6D259|ISCS_PECAS Cysteine desulfurase IscS OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=iscS PE=3 SV=1 95 273 7.0E-08
sp|B5XNJ7|ISCS_KLEP3 Cysteine desulfurase IscS OS=Klebsiella pneumoniae (strain 342) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|Q7MNG2|ISCS_VIBVY Cysteine desulfurase IscS OS=Vibrio vulnificus (strain YJ016) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|Q8ZN40|ISCS_SALTY Cysteine desulfurase IscS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|B5BAW6|ISCS_SALPK Cysteine desulfurase IscS OS=Salmonella paratyphi A (strain AKU_12601) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|A9N1X5|ISCS_SALPB Cysteine desulfurase IscS OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|Q5PNG1|ISCS_SALPA Cysteine desulfurase IscS OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|B4T0S2|ISCS_SALNS Cysteine desulfurase IscS OS=Salmonella newport (strain SL254) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|B4TDB6|ISCS_SALHS Cysteine desulfurase IscS OS=Salmonella heidelberg (strain SL476) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|B5RD12|ISCS_SALG2 Cysteine desulfurase IscS OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|B5R5A2|ISCS_SALEP Cysteine desulfurase IscS OS=Salmonella enteritidis PT4 (strain P125109) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|B5FR85|ISCS_SALDC Cysteine desulfurase IscS OS=Salmonella dublin (strain CT_02021853) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|Q57LG9|ISCS_SALCH Cysteine desulfurase IscS OS=Salmonella choleraesuis (strain SC-B67) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|B5F1C0|ISCS_SALA4 Cysteine desulfurase IscS OS=Salmonella agona (strain SL483) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|B4TRX5|ISCS_SALSV Cysteine desulfurase IscS OS=Salmonella schwarzengrund (strain CVM19633) GN=iscS PE=3 SV=1 95 273 8.0E-08
sp|A8FXA5|ISCS_SHESH Cysteine desulfurase IscS OS=Shewanella sediminis (strain HAW-EB3) GN=iscS PE=3 SV=1 95 285 8.0E-08
sp|Q8Z4N0|ISCS_SALTI Cysteine desulfurase IscS OS=Salmonella typhi GN=iscS PE=3 SV=1 95 273 9.0E-08
sp|Q8DEY7|ISCS_VIBVU Cysteine desulfurase IscS OS=Vibrio vulnificus (strain CMCP6) GN=iscS PE=3 SV=1 95 273 9.0E-08
sp|A4WDB1|ISCS_ENT38 Cysteine desulfurase IscS OS=Enterobacter sp. (strain 638) GN=iscS PE=3 SV=1 95 273 1.0E-07
sp|Q12P83|ISCS_SHEDO Cysteine desulfurase IscS OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=iscS PE=3 SV=1 95 273 1.0E-07
sp|Q54X04|NFS1_DICDI Probable cysteine desulfurase, mitochondrial OS=Dictyostelium discoideum GN=nfs1 PE=1 SV=1 94 290 1.0E-07
sp|Q9V242|CSD_PYRAB Probable cysteine desulfurase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=csd PE=3 SV=1 96 273 1.0E-07
sp|C0PYK7|ISCS_SALPC Cysteine desulfurase IscS OS=Salmonella paratyphi C (strain RKS4594) GN=iscS PE=3 SV=1 95 385 2.0E-07
sp|B2US50|ISCS_HELPS Cysteine desulfurase IscS OS=Helicobacter pylori (strain Shi470) GN=iscS PE=3 SV=1 100 273 2.0E-07
sp|A4SP14|ISCS_AERS4 Cysteine desulfurase IscS OS=Aeromonas salmonicida (strain A449) GN=iscS PE=3 SV=1 95 273 2.0E-07
sp|A3QFD5|ISCS_SHELP Cysteine desulfurase IscS OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=iscS PE=3 SV=1 95 285 2.0E-07
sp|O25008|ISCS_HELPY Cysteine desulfurase IscS OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=iscS PE=1 SV=1 100 273 2.0E-07
sp|B6JKF2|ISCS_HELP2 Cysteine desulfurase IscS OS=Helicobacter pylori (strain P12) GN=iscS PE=3 SV=1 100 273 2.0E-07
sp|B1KNI3|ISCS_SHEWM Cysteine desulfurase IscS OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=iscS PE=3 SV=1 95 273 2.0E-07
sp|B2VI32|ISCS_ERWT9 Cysteine desulfurase IscS OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=iscS PE=3 SV=1 95 276 2.0E-07
sp|Q52069|NIFS_ENTAG Cysteine desulfurase OS=Enterobacter agglomerans GN=nifS PE=3 SV=1 95 282 2.0E-07
sp|B0YLW6|NFS1_TRAHO Cysteine desulfurase, mitosomal OS=Trachipleistophora hominis GN=NFS1 PE=1 SV=1 89 272 2.0E-07
sp|Q49690|CSD2_MYCLE Probable cysteine desulfurase 2 OS=Mycobacterium leprae (strain TN) GN=csd2 PE=3 SV=1 56 372 3.0E-07
sp|O60028|NFS1_ASHGO Cysteine desulfurase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NFS1 PE=3 SV=1 95 294 3.0E-07
sp|Q6LU62|ISCS_PHOPR Cysteine desulfurase IscS OS=Photobacterium profundum GN=iscS PE=3 SV=1 95 273 4.0E-07
sp|A9MHJ4|ISCS_SALAR Cysteine desulfurase IscS OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=iscS PE=3 SV=1 95 273 4.0E-07
sp|O49543|MNIF1_ARATH Cysteine desulfurase, mitochondrial OS=Arabidopsis thaliana GN=NIFS1 PE=1 SV=1 95 276 4.0E-07
sp|Q9VKD3|NFS1_DROME Probable cysteine desulfurase, mitochondrial OS=Drosophila melanogaster GN=CG12264 PE=2 SV=1 95 276 5.0E-07
sp|A8GNU0|ISCS_RICAH Cysteine desulfurase IscS OS=Rickettsia akari (strain Hartford) GN=iscS PE=3 SV=1 93 294 5.0E-07
sp|Q1RHY6|ISCS_RICBR Cysteine desulfurase IscS OS=Rickettsia bellii (strain RML369-C) GN=iscS PE=3 SV=1 95 293 8.0E-07
sp|B8F356|ISCS_HAEPS Cysteine desulfurase IscS OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=iscS PE=3 SV=1 95 273 9.0E-07
sp|A8H2M6|ISCS_SHEPA Cysteine desulfurase IscS OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=iscS PE=3 SV=1 95 273 1.0E-06
sp|P12623|NIFS_NOSS1 Cysteine desulfurase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifS PE=3 SV=3 98 273 1.0E-06
sp|B8D8B6|ISCS_BUCAT Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=iscS PE=3 SV=1 94 273 1.0E-06
sp|P57657|ISCS_BUCAI Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=iscS PE=3 SV=1 94 273 1.0E-06
sp|B8D8F9|ISCS_BUCA5 Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=iscS PE=3 SV=1 94 273 1.0E-06
sp|Q9ZML2|ISCS_HELPJ Cysteine desulfurase IscS OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=iscS PE=3 SV=1 100 273 2.0E-06
sp|A8GWB2|ISCS_RICB8 Cysteine desulfurase IscS OS=Rickettsia bellii (strain OSU 85-389) GN=iscS PE=3 SV=1 95 293 2.0E-06
sp|B0TNY1|ISCS_SHEHH Cysteine desulfurase IscS OS=Shewanella halifaxensis (strain HAW-EB4) GN=iscS PE=3 SV=1 95 273 2.0E-06
sp|Q43884|NIFS_TRIAZ Cysteine desulfurase OS=Trichormus azollae GN=nifS PE=3 SV=1 98 273 3.0E-06
sp|Q44507|NIFS1_ANAVT Cysteine desulfurase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nifS1 PE=3 SV=2 98 273 3.0E-06
sp|C5BEU5|ISCS_EDWI9 Cysteine desulfurase IscS OS=Edwardsiella ictaluri (strain 93-146) GN=iscS PE=3 SV=1 95 273 3.0E-06
sp|B8CMW5|ISCS_SHEPW Cysteine desulfurase IscS OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=iscS PE=3 SV=1 95 273 3.0E-06
sp|Q87S28|ISCS_VIBPA Cysteine desulfurase IscS OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=iscS PE=3 SV=1 95 273 3.0E-06
sp|A7MU48|ISCS_VIBCB Cysteine desulfurase IscS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=iscS PE=3 SV=1 95 273 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2350
MTAQSGEAVHAATHTIELGIWEPIKIMAQGKVEEMRRRFGGEWKDEFPFDPEWHNLNHGSFGSIPIAIRDKLREY
QDQVEARPDRFIRYDYPRLLDESREAVARLIKAPVDSVVFVSNATEGLNTVFRNLVWAEDGRDVIMSFSTIYEAC
GKMIDYIVDYYGGLVTHYEIGLEYPVEDETILQAFRDAVNGIQSQGKRARACLFDVVSSRPGVVFPWEAMVAECK
NLGVMSIVDGAQGIGMLPLDMVAVDADVFVSNCHKWLYVPRGCAVLYVPVRNQGWLPTTLATSHGYVAKADSSRG
SPLPPNSKSAFVNNFEFVGTKDNSPYLCVKDAIEWRRHVLGGEDAIIAHLWNLNKTGVRHVADVLGTQMLENSAG
TLTNCAMGNVALPIWIGQRGKAARDTDVVVAADKADKAFQWMAVSMVQDYKTFISLFVMGKRFWVRLSAQIYLDM
SDYEFAAKMLTELTQRAGKHEYLGV*
Coding >OphauB2|2350
ATGACGGCTCAGAGCGGGGAAGCGGTACACGCTGCTACGCATACGATTGAGCTAGGAATCTGGGAACCGATAAAA
ATAATGGCTCAAGGGAAAGTTGAAGAAATGAGGAGGCGCTTTGGGGGAGAGTGGAAAGACGAGTTTCCATTTGAT
CCTGAGTGGCACAATCTAAATCATGGCTCGTTTGGAAGCATCCCCATTGCCATTCGTGATAAGCTGCGCGAGTAC
CAGGACCAAGTCGAGGCACGGCCGGACCGCTTCATCCGCTACGACTATCCGCGGCTGCTTGACGAGTCGCGAGAG
GCAGTGGCCAGGCTGATCAAGGCGCCCGTTGACAGTGTCGTCTTTGTCTCCAATGCGACCGAAGGGCTCAACACA
GTCTTTCGCAACCTTGTCTGGGCCGAAGACGGGCGCGATGTCATCATGAGCTTTTCTACAATTTACGAGGCCTGT
GGGAAAATGATTGACTACATTGTCGACTACTATGGCGGCCTTGTTACACATTACGAAATTGGCCTCGAGTATCCG
GTTGAGGACGAGACCATTTTGCAGGCCTTTAGAGATGCGGTCAACGGCATCCAGAGCCAGGGCAAGAGAGCACGT
GCATGTCTTTTTGACGTTGTCTCGTCTCGGCCCGGCGTCGTTTTTCCGTGGGAGGCCATGGTGGCCGAATGCAAG
AATCTGGGCGTCATGAGCATCGTGGACGGCGCACAGGGCATCGGAATGCTACCGCTAGACATGGTGGCAGTCGAC
GCAGATGTCTTTGTCTCAAACTGCCACAAGTGGCTGTACGTGCCTCGGGGCTGTGCCGTCTTGTATGTGCCTGTG
CGAAATCAAGGCTGGCTGCCGACAACACTGGCCACCAGTCATGGTTATGTGGCCAAGGCAGACTCGAGCAGAGGC
AGCCCGCTGCCGCCCAACAGCAAGAGCGCCTTTGTTAACAACTTTGAGTTTGTCGGCACCAAGGACAATAGCCCG
TATCTCTGCGTCAAGGATGCCATTGAATGGCGGCGCCATGTCCTTGGCGGCGAGGACGCCATCATTGCCCACCTG
TGGAACCTCAACAAGACGGGCGTGCGTCATGTTGCCGACGTGCTGGGCACACAGATGCTGGAAAACAGCGCGGGC
ACTCTGACAAACTGCGCCATGGGCAATGTGGCCCTGCCCATCTGGATTGGACAGCGAGGCAAAGCTGCCCGTGAC
ACTGATGTTGTAGTAGCAGCCGACAAGGCAGACAAGGCGTTTCAGTGGATGGCTGTTTCCATGGTGCAAGACTAT
AAGACGTTTATTTCGCTCTTTGTCATGGGAAAGCGCTTCTGGGTGCGCTTGAGTGCTCAAATATATCTTGACATG
AGCGACTATGAGTTTGCGGCCAAGATGCTTACCGAGTTGACGCAGAGAGCAGGCAAGCACGAATACTTAGGAGTA
TAA
Transcript >OphauB2|2350
ATGACGGCTCAGAGCGGGGAAGCGGTACACGCTGCTACGCATACGATTGAGCTAGGAATCTGGGAACCGATAAAA
ATAATGGCTCAAGGGAAAGTTGAAGAAATGAGGAGGCGCTTTGGGGGAGAGTGGAAAGACGAGTTTCCATTTGAT
CCTGAGTGGCACAATCTAAATCATGGCTCGTTTGGAAGCATCCCCATTGCCATTCGTGATAAGCTGCGCGAGTAC
CAGGACCAAGTCGAGGCACGGCCGGACCGCTTCATCCGCTACGACTATCCGCGGCTGCTTGACGAGTCGCGAGAG
GCAGTGGCCAGGCTGATCAAGGCGCCCGTTGACAGTGTCGTCTTTGTCTCCAATGCGACCGAAGGGCTCAACACA
GTCTTTCGCAACCTTGTCTGGGCCGAAGACGGGCGCGATGTCATCATGAGCTTTTCTACAATTTACGAGGCCTGT
GGGAAAATGATTGACTACATTGTCGACTACTATGGCGGCCTTGTTACACATTACGAAATTGGCCTCGAGTATCCG
GTTGAGGACGAGACCATTTTGCAGGCCTTTAGAGATGCGGTCAACGGCATCCAGAGCCAGGGCAAGAGAGCACGT
GCATGTCTTTTTGACGTTGTCTCGTCTCGGCCCGGCGTCGTTTTTCCGTGGGAGGCCATGGTGGCCGAATGCAAG
AATCTGGGCGTCATGAGCATCGTGGACGGCGCACAGGGCATCGGAATGCTACCGCTAGACATGGTGGCAGTCGAC
GCAGATGTCTTTGTCTCAAACTGCCACAAGTGGCTGTACGTGCCTCGGGGCTGTGCCGTCTTGTATGTGCCTGTG
CGAAATCAAGGCTGGCTGCCGACAACACTGGCCACCAGTCATGGTTATGTGGCCAAGGCAGACTCGAGCAGAGGC
AGCCCGCTGCCGCCCAACAGCAAGAGCGCCTTTGTTAACAACTTTGAGTTTGTCGGCACCAAGGACAATAGCCCG
TATCTCTGCGTCAAGGATGCCATTGAATGGCGGCGCCATGTCCTTGGCGGCGAGGACGCCATCATTGCCCACCTG
TGGAACCTCAACAAGACGGGCGTGCGTCATGTTGCCGACGTGCTGGGCACACAGATGCTGGAAAACAGCGCGGGC
ACTCTGACAAACTGCGCCATGGGCAATGTGGCCCTGCCCATCTGGATTGGACAGCGAGGCAAAGCTGCCCGTGAC
ACTGATGTTGTAGTAGCAGCCGACAAGGCAGACAAGGCGTTTCAGTGGATGGCTGTTTCCATGGTGCAAGACTAT
AAGACGTTTATTTCGCTCTTTGTCATGGGAAAGCGCTTCTGGGTGCGCTTGAGTGCTCAAATATATCTTGACATG
AGCGACTATGAGTTTGCGGCCAAGATGCTTACCGAGTTGACGCAGAGAGCAGGCAAGCACGAATACTTAGGAGTA
TAA
Gene >OphauB2|2350
ATGACGGCTCAGAGCGGGGAAGCGGTACACGCTGCTACGCATACGATTGAGCTAGGAATCTGGGAACCGATAAGT
AGGCATCTGTTGCTATAAAATGCTCGATTGATTTTTTTTTGTTAATTTGCTCTAGAAATAATGGCTCAAGGGAAA
GTTGAAGAAATGAGGAGGCGCTTTGGGGGAGAGTGGAAAGACGAGTTTCCATTTGATCCTGAGTGGCACAATCTA
AATCATGGTGAGTCAGACTCAACTGTTGTTGAAACAACACACTCGAATGCTCATGTTACGGCTCGCAATGGCTCA
AAAGGCTCGTTTGGAAGCATCCCCATTGCCATTCGTGATAAGCTGCGCGAGTACCAGGACCAAGTCGAGGCACGG
CCGGACCGCTTCATCCGCTACGACTATCCGCGGCTGCTTGACGAGTCGCGAGAGGCAGTGGCCAGGCTGATCAAG
GCGCCCGTTGACAGTGTCGTCTTTGTCTCCAATGCGACCGAAGGGCTCAACACAGTCTTTCGCAACCTTGTCTGG
GCCGAAGACGGGCGCGATGTCATCATGAGCTTTTCTACAATTTACGAGGCCTGTGGGAAAATGATTGACTACATT
GTCGACTACTATGGCGGCCTTGTTACACATTACGAAATTGGCCTCGAGTATCCGGTTGAGGACGAGACCATTTTG
CAGGCCTTTAGAGATGCGGTCAACGGCATCCAGAGCCAGGGCAAGAGAGCACGTGCATGTCTTTTTGACGTTGTC
TCGTCTCGGCCCGGCGTCGTTTTTCCGTGGGAGGCCATGGTGGCCGAATGCAAGAATCTGGGCGTCATGAGCATC
GTGGACGGCGCACAGGGCATCGGAATGCTACCGCTAGACATGGTGGCAGTCGACGCAGATGTCTTTGTCTCAAAC
TGCCACAAGTGGCTGTACGTGCCTCGGGGCTGTGCCGTCTTGTATGTGCCTGTGCGAAATCAAGGCTGGCTGCCG
ACAACACTGGCCACCAGTCATGGTTATGTGGCCAAGGCAGACTCGAGCAGAGGCAGCCCGCTGCCGCCCAACAGC
AAGAGCGCCTTTGTTAACAACTTTGAGTTTGTCGGCACCAAGGACAATAGCCCGTATCTCTGCGTCAAGGATGCC
ATTGAATGGCGGCGCCATGTCCTTGGCGGCGAGGACGCCATCATTGCCCACCTGTGGAACCTCAACAAGACGGGC
GTGCGTCATGTTGCCGACGTGCTGGGCACACAGATGCTGGAAAACAGCGCGGGCACTCTGACAAACTGCGCCATG
GGCAATGTGGCCCTGCCCATCTGGATTGGACAGCGAGGCAAAGCTGCCCGTGACACTGATGTTGTAGTAGCAGCC
GACAAGGCAGACAAGGCGTTTCAGTGGATGGCTGTTTCCATGGTGCAAGACTATAAGACGTTTATTTCGCTCTTT
GTCATGGGAAAGCGCTTCTGGGTGCGCTTGAGTGCTCAAATATATCTTGACATGAGCGACTATGAGTTTGCGGCC
AAGATGCTTACCGAGTTGACGCAGAGAGCAGGCAAGCACGAATACTTAGGAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail