Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2309
Gene name
LocationContig_17:216511..217976
Strand+
Gene length (bp)1465
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00206 Lyase_1 Lyase 8.3E-85 15 311
PF14698 ASL_C2 Argininosuccinate lyase C-terminal 7.3E-25 373 441

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50514|ARLZ_SCHPO Probable argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=argx PE=3 SV=1 1 466 0.0E+00
sp|P43061|ARLY_CANAX Argininosuccinate lyase OS=Candida albicans GN=ARG4 PE=3 SV=1 4 465 0.0E+00
sp|P41906|ARLY_SACPA Argininosuccinate lyase OS=Saccharomyces paradoxus GN=ARG4 PE=3 SV=1 8 466 0.0E+00
sp|P04076|ARLY_YEAST Argininosuccinate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG4 PE=1 SV=2 8 466 0.0E+00
sp|P40369|ARLY_SCHPO Argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg7 PE=3 SV=2 12 465 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50514|ARLZ_SCHPO Probable argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=argx PE=3 SV=1 1 466 0.0E+00
sp|P43061|ARLY_CANAX Argininosuccinate lyase OS=Candida albicans GN=ARG4 PE=3 SV=1 4 465 0.0E+00
sp|P41906|ARLY_SACPA Argininosuccinate lyase OS=Saccharomyces paradoxus GN=ARG4 PE=3 SV=1 8 466 0.0E+00
sp|P04076|ARLY_YEAST Argininosuccinate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG4 PE=1 SV=2 8 466 0.0E+00
sp|P40369|ARLY_SCHPO Argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg7 PE=3 SV=2 12 465 0.0E+00
sp|P51464|ARLY_LITCT Argininosuccinate lyase OS=Lithobates catesbeiana GN=ASL PE=3 SV=1 8 465 0.0E+00
sp|P24058|ARLY2_ANAPL Argininosuccinate lyase OS=Anas platyrhynchos GN=ASL2 PE=1 SV=4 1 465 7.0E-180
sp|P05083|ARLY2_CHICK Argininosuccinate lyase OS=Gallus gallus GN=ASL2 PE=2 SV=1 8 465 8.0E-174
sp|Q3SZJ0|ARLY_BOVIN Argininosuccinate lyase OS=Bos taurus GN=ASL PE=2 SV=1 1 465 2.0E-173
sp|P04424|ARLY_HUMAN Argininosuccinate lyase OS=Homo sapiens GN=ASL PE=1 SV=4 1 465 2.0E-173
sp|Q91YI0|ARLY_MOUSE Argininosuccinate lyase OS=Mus musculus GN=Asl PE=1 SV=1 1 465 2.0E-172
sp|P20673|ARLY_RAT Argininosuccinate lyase OS=Rattus norvegicus GN=Asl PE=2 SV=1 12 465 2.0E-172
sp|Q60HH3|ARLY_MACFA Argininosuccinate lyase OS=Macaca fascicularis GN=ASL PE=2 SV=1 1 465 4.0E-172
sp|P22675|ARLY_CHLRE Argininosuccinate lyase OS=Chlamydomonas reinhardtii GN=ARG7 PE=2 SV=2 12 465 2.0E-171
sp|P33110|ARLY_ANSAN Argininosuccinate lyase OS=Anser anser anser GN=ASL PE=1 SV=1 8 465 1.0E-170
sp|P24057|ARLY1_ANAPL Delta-1 crystallin OS=Anas platyrhynchos GN=ASL1 PE=1 SV=1 8 465 8.0E-170
sp|Q01592|ARLY_COLLI Argininosuccinate lyase OS=Columba livia GN=ASL PE=1 SV=1 8 465 2.0E-167
sp|P02521|ARLY1_CHICK Delta-1 crystallin OS=Gallus gallus GN=ASL1 PE=1 SV=2 8 465 1.0E-158
sp|Q7SIE0|ARLY1_MELGA Delta-1 crystallin OS=Meleagris gallopavo GN=ASL1 PE=1 SV=1 8 465 6.0E-158
sp|A5UVX7|ARLY_ROSS1 Argininosuccinate lyase OS=Roseiflexus sp. (strain RS-1) GN=argH PE=3 SV=1 12 458 1.0E-148
sp|A7NF38|ARLY_ROSCS Argininosuccinate lyase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=argH PE=3 SV=1 12 465 1.0E-141
sp|Q98G36|ARLY1_RHILO Argininosuccinate lyase 1 OS=Rhizobium loti (strain MAFF303099) GN=argH1 PE=3 SV=1 4 459 4.0E-140
sp|Q8R7C3|ARLY_CALS4 Argininosuccinate lyase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argH PE=3 SV=1 12 447 7.0E-138
sp|A1UQY9|ARLY_BARBK Argininosuccinate lyase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=argH PE=3 SV=1 10 458 2.0E-135
sp|Q8GDU5|ARLY_HELMO Argininosuccinate lyase (Fragment) OS=Heliobacillus mobilis PE=3 SV=1 12 465 3.0E-135
sp|A9AWL1|ARLY_HERA2 Argininosuccinate lyase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=argH PE=3 SV=1 12 458 1.0E-134
sp|Q11DW5|ARLY_CHESB Argininosuccinate lyase OS=Chelativorans sp. (strain BNC1) GN=argH PE=3 SV=1 4 459 3.0E-134
sp|Q24ZG7|ARLY_DESHY Argininosuccinate lyase OS=Desulfitobacterium hafniense (strain Y51) GN=argH PE=3 SV=1 12 458 1.0E-133
sp|B8FWX3|ARLY_DESHD Argininosuccinate lyase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=argH PE=3 SV=1 12 458 1.0E-133
sp|B3E9X6|ARLY_GEOLS Argininosuccinate lyase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=argH PE=3 SV=1 10 463 1.0E-133
sp|A5GDA7|ARLY_GEOUR Argininosuccinate lyase OS=Geobacter uraniireducens (strain Rf4) GN=argH PE=3 SV=1 12 458 8.0E-133
sp|A6Q2R2|ARLY_NITSB Argininosuccinate lyase OS=Nitratiruptor sp. (strain SB155-2) GN=argH PE=3 SV=1 12 466 2.0E-132
sp|Q8YJJ7|ARLY_BRUME Argininosuccinate lyase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=argH PE=3 SV=1 4 459 2.0E-132
sp|C0RFM4|ARLY_BRUMB Argininosuccinate lyase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=argH PE=3 SV=1 4 459 2.0E-132
sp|Q57AS3|ARLY_BRUAB Argininosuccinate lyase OS=Brucella abortus biovar 1 (strain 9-941) GN=argH PE=3 SV=1 4 459 2.0E-132
sp|Q2YR87|ARLY_BRUA2 Argininosuccinate lyase OS=Brucella abortus (strain 2308) GN=argH PE=3 SV=1 4 459 2.0E-132
sp|B2S8N8|ARLY_BRUA1 Argininosuccinate lyase OS=Brucella abortus (strain S19) GN=argH PE=3 SV=1 4 459 2.0E-132
sp|Q65G68|ARLY_BACLD Argininosuccinate lyase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=argH PE=3 SV=1 12 466 2.0E-132
sp|A7ZC90|ARLY_CAMC1 Argininosuccinate lyase OS=Campylobacter concisus (strain 13826) GN=argH PE=3 SV=1 12 465 3.0E-132
sp|Q817C7|ARLY_BACCR Argininosuccinate lyase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=argH PE=3 SV=1 12 459 4.0E-132
sp|Q8FYA4|ARLY_BRUSU Argininosuccinate lyase OS=Brucella suis biovar 1 (strain 1330) GN=argH PE=3 SV=1 4 459 6.0E-132
sp|B0CIY4|ARLY_BRUSI Argininosuccinate lyase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=argH PE=3 SV=1 4 459 6.0E-132
sp|A9M968|ARLY_BRUC2 Argininosuccinate lyase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=argH PE=3 SV=1 4 459 6.0E-132
sp|B9M377|ARLY_GEODF Argininosuccinate lyase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=argH PE=3 SV=1 12 462 6.0E-132
sp|B7H6Y4|ARLY_BACC4 Argininosuccinate lyase OS=Bacillus cereus (strain B4264) GN=argH PE=3 SV=1 12 459 1.0E-131
sp|A1ATU1|ARLY_PELPD Argininosuccinate lyase OS=Pelobacter propionicus (strain DSM 2379) GN=argH PE=3 SV=1 12 462 1.0E-131
sp|O34858|ARLY_BACSU Argininosuccinate lyase OS=Bacillus subtilis (strain 168) GN=argH PE=3 SV=1 12 454 1.0E-131
sp|B8GD12|ARLY_CHLAD Argininosuccinate lyase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=argH PE=3 SV=1 9 465 2.0E-131
sp|Q8ELT9|ARLY_OCEIH Argininosuccinate lyase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argH PE=3 SV=1 12 466 4.0E-131
sp|A7Z7L9|ARLY_BACMF Argininosuccinate lyase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=argH PE=3 SV=1 12 454 5.0E-131
sp|A7GXA8|ARLY_CAMC5 Argininosuccinate lyase OS=Campylobacter curvus (strain 525.92) GN=argH PE=3 SV=1 12 465 5.0E-131
sp|A6WXL6|ARLY_OCHA4 Argininosuccinate lyase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=argH PE=3 SV=1 10 459 7.0E-131
sp|A9VKE0|ARLY_BACWK Argininosuccinate lyase OS=Bacillus weihenstephanensis (strain KBAB4) GN=argH PE=3 SV=1 12 449 9.0E-131
sp|B0K4D9|ARLY_THEPX Argininosuccinate lyase OS=Thermoanaerobacter sp. (strain X514) GN=argH PE=3 SV=1 12 435 1.0E-130
sp|B0KBW6|ARLY_THEP3 Argininosuccinate lyase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=argH PE=3 SV=1 12 435 1.0E-130
sp|Q39Z69|ARLY_GEOMG Argininosuccinate lyase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=argH PE=3 SV=1 12 458 2.0E-130
sp|Q169X5|ARLY_ROSDO Argininosuccinate lyase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=argH PE=3 SV=1 10 465 2.0E-130
sp|B7IK28|ARLY_BACC2 Argininosuccinate lyase OS=Bacillus cereus (strain G9842) GN=argH PE=3 SV=1 12 459 2.0E-130
sp|B9MRP4|ARLY_CALBD Argininosuccinate lyase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=argH PE=3 SV=1 12 466 2.0E-130
sp|A1B3M0|ARLY_PARDP Argininosuccinate lyase OS=Paracoccus denitrificans (strain Pd 1222) GN=argH PE=3 SV=1 10 466 3.0E-130
sp|Q3A1V0|ARLY_PELCD Argininosuccinate lyase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=argH PE=3 SV=1 13 458 3.0E-130
sp|Q81KV8|ARLY_BACAN Argininosuccinate lyase OS=Bacillus anthracis GN=argH-2 PE=3 SV=1 12 449 4.0E-130
sp|C3L913|ARLY_BACAC Argininosuccinate lyase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=argH PE=3 SV=1 12 449 4.0E-130
sp|C3PB96|ARLY_BACAA Argininosuccinate lyase OS=Bacillus anthracis (strain A0248) GN=argH PE=3 SV=1 12 449 4.0E-130
sp|B7HRS6|ARLY_BACC7 Argininosuccinate lyase OS=Bacillus cereus (strain AH187) GN=argH PE=3 SV=1 12 449 4.0E-130
sp|Q633G5|ARLY_BACCZ Argininosuccinate lyase OS=Bacillus cereus (strain ZK / E33L) GN=argH PE=3 SV=1 12 449 4.0E-130
sp|Q74GT9|ARLY_GEOSL Argininosuccinate lyase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=argH PE=3 SV=1 12 458 4.0E-130
sp|Q1MQL6|ARLY_LAWIP Argininosuccinate lyase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=argH PE=3 SV=1 12 465 4.0E-130
sp|Q72ZA4|ARLY_BACC1 Argininosuccinate lyase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=argH PE=3 SV=1 12 449 8.0E-130
sp|A7I3C8|ARLY_CAMHC Argininosuccinate lyase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=argH PE=3 SV=1 12 465 1.0E-129
sp|A3PMB7|ARLY_RHOS1 Argininosuccinate lyase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=argH PE=3 SV=1 2 465 2.0E-129
sp|C6BTR8|ARLY_DESAD Argininosuccinate lyase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=argH PE=3 SV=1 8 462 2.0E-129
sp|A7HTI8|ARLY_PARL1 Argininosuccinate lyase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=argH PE=3 SV=1 10 465 2.0E-129
sp|B9LD91|ARLY_CHLSY Argininosuccinate lyase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=argH PE=3 SV=1 9 465 2.0E-129
sp|A9WJR8|ARLY_CHLAA Argininosuccinate lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=argH PE=3 SV=1 9 465 2.0E-129
sp|Q92MH1|ARLY1_RHIME Argininosuccinate lyase 1 OS=Rhizobium meliloti (strain 1021) GN=argH1 PE=3 SV=1 3 458 3.0E-129
sp|B5ED16|ARLY_GEOBB Argininosuccinate lyase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=argH PE=3 SV=1 12 458 4.0E-129
sp|A4J174|ARLY_DESRM Argininosuccinate lyase OS=Desulfotomaculum reducens (strain MI-1) GN=argH PE=3 SV=1 12 458 6.0E-129
sp|B7JS05|ARLY_BACC0 Argininosuccinate lyase OS=Bacillus cereus (strain AH820) GN=argH PE=3 SV=1 12 449 6.0E-129
sp|A6TL09|ARLY_ALKMQ Argininosuccinate lyase OS=Alkaliphilus metalliredigens (strain QYMF) GN=argH PE=3 SV=1 12 455 8.0E-129
sp|Q67S72|ARLY_SYMTH Argininosuccinate lyase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=argH PE=3 SV=1 12 465 8.0E-129
sp|Q3IZY2|ARLY_RHOS4 Argininosuccinate lyase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=argH PE=3 SV=1 2 465 8.0E-129
sp|A0RJM3|ARLY_BACAH Argininosuccinate lyase OS=Bacillus thuringiensis (strain Al Hakam) GN=argH PE=3 SV=1 12 459 9.0E-129
sp|C3MHU1|ARLY_RHISN Argininosuccinate lyase OS=Rhizobium sp. (strain NGR234) GN=argH PE=3 SV=1 3 458 1.0E-128
sp|Q2K3P2|ARLY_RHIEC Argininosuccinate lyase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=argH PE=3 SV=1 1 462 1.0E-128
sp|C5BC57|ARLY_EDWI9 Argininosuccinate lyase OS=Edwardsiella ictaluri (strain 93-146) GN=argH PE=3 SV=1 12 458 1.0E-128
sp|B1I1D1|ARLY_DESAP Argininosuccinate lyase OS=Desulforudis audaxviator (strain MP104C) GN=argH PE=3 SV=1 12 454 1.0E-128
sp|B1YJ36|ARLY_EXIS2 Argininosuccinate lyase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=argH PE=3 SV=1 12 466 1.0E-128
sp|A6M1Z5|ARLY_CLOB8 Argininosuccinate lyase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=argH PE=3 SV=1 12 465 1.0E-128
sp|Q30YB9|ARLY_DESAG Argininosuccinate lyase OS=Desulfovibrio alaskensis (strain G20) GN=argH PE=3 SV=1 12 465 1.0E-128
sp|Q6HCP8|ARLY_BACHK Argininosuccinate lyase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argH PE=3 SV=1 12 449 2.0E-128
sp|A7GTR4|ARLY_BACCN Argininosuccinate lyase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=argH PE=3 SV=1 12 449 2.0E-128
sp|B8DN65|ARLY_DESVM Argininosuccinate lyase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=argH PE=3 SV=1 8 458 2.0E-128
sp|A1VEQ1|ARLY_DESVV Argininosuccinate lyase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=argH PE=3 SV=1 8 458 4.0E-128
sp|Q72D36|ARLY_DESVH Argininosuccinate lyase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=argH PE=3 SV=1 8 458 4.0E-128
sp|A4WVB9|ARLY_RHOS5 Argininosuccinate lyase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=argH PE=3 SV=1 2 465 4.0E-128
sp|B3PPC1|ARLY_RHIE6 Argininosuccinate lyase OS=Rhizobium etli (strain CIAT 652) GN=argH PE=3 SV=1 10 462 4.0E-128
sp|Q8U9X6|ARLY1_AGRFC Argininosuccinate lyase 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=argH1 PE=3 SV=2 10 458 5.0E-128
sp|Q15X84|ARLY_PSEA6 Argininosuccinate lyase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=argH PE=3 SV=1 12 458 6.0E-128
sp|B4S0H4|ARLY_ALTMD Argininosuccinate lyase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=argH PE=3 SV=1 12 458 6.0E-128
sp|C5D678|ARLY_GEOSW Argininosuccinate lyase OS=Geobacillus sp. (strain WCH70) GN=argH PE=3 SV=1 12 466 6.0E-128
sp|A4IRS2|ARLY_GEOTN Argininosuccinate lyase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=argH PE=3 SV=1 12 465 7.0E-128
sp|A8FG69|ARLY_BACP2 Argininosuccinate lyase OS=Bacillus pumilus (strain SAFR-032) GN=argH PE=3 SV=1 12 449 7.0E-128
sp|B7LUN5|ARLY_ESCF3 Argininosuccinate lyase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=argH PE=3 SV=1 12 458 1.0E-127
sp|B8IZS3|ARLY_DESDA Argininosuccinate lyase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=argH PE=3 SV=1 10 465 1.0E-127
sp|P59619|ARLY_SHIFL Argininosuccinate lyase OS=Shigella flexneri GN=argH PE=3 SV=1 12 458 1.0E-127
sp|Q0SY34|ARLY_SHIF8 Argininosuccinate lyase OS=Shigella flexneri serotype 5b (strain 8401) GN=argH PE=3 SV=1 12 458 1.0E-127
sp|Q1MB73|ARLY_RHIL3 Argininosuccinate lyase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=argH PE=3 SV=2 10 462 2.0E-127
sp|Q5LXC0|ARLY_RUEPO Argininosuccinate lyase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=argH PE=3 SV=1 10 465 3.0E-127
sp|B7NFR0|ARLY_ECOLU Argininosuccinate lyase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=argH PE=3 SV=1 12 458 3.0E-127
sp|P11447|ARLY_ECOLI Argininosuccinate lyase OS=Escherichia coli (strain K12) GN=argH PE=1 SV=3 12 458 3.0E-127
sp|B1IVB8|ARLY_ECOLC Argininosuccinate lyase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=argH PE=3 SV=1 12 458 3.0E-127
sp|A8A768|ARLY_ECOHS Argininosuccinate lyase OS=Escherichia coli O9:H4 (strain HS) GN=argH PE=3 SV=1 12 458 3.0E-127
sp|B1XBC5|ARLY_ECODH Argininosuccinate lyase OS=Escherichia coli (strain K12 / DH10B) GN=argH PE=3 SV=1 12 458 3.0E-127
sp|C5A0Q9|ARLY_ECOBW Argininosuccinate lyase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=argH PE=3 SV=1 12 458 3.0E-127
sp|A4XKG3|ARLY_CALS8 Argininosuccinate lyase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=argH PE=3 SV=1 12 465 3.0E-127
sp|Q1WV66|ARLY_LACS1 Argininosuccinate lyase OS=Lactobacillus salivarius (strain UCC118) GN=argH PE=3 SV=1 12 466 3.0E-127
sp|C6E6Y9|ARLY_GEOSM Argininosuccinate lyase OS=Geobacter sp. (strain M21) GN=argH PE=3 SV=1 12 458 4.0E-127
sp|B8FH31|ARLY_DESAA Argininosuccinate lyase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=argH PE=3 SV=1 13 458 4.0E-127
sp|B9JTJ2|ARLY_AGRVS Argininosuccinate lyase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=argH PE=3 SV=1 1 459 5.0E-127
sp|B7NU40|ARLY_ECO7I Argininosuccinate lyase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=argH PE=3 SV=1 12 458 5.0E-127
sp|B8I1A0|ARLY_CLOCE Argininosuccinate lyase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=argH PE=3 SV=1 12 453 6.0E-127
sp|Q32AB5|ARLY_SHIDS Argininosuccinate lyase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=argH PE=3 SV=1 12 458 7.0E-127
sp|B7GGR5|ARLY_ANOFW Argininosuccinate lyase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=argH PE=3 SV=1 12 466 1.0E-126
sp|B6I5H6|ARLY_ECOSE Argininosuccinate lyase OS=Escherichia coli (strain SE11) GN=argH PE=3 SV=1 12 458 2.0E-126
sp|B7M714|ARLY_ECO8A Argininosuccinate lyase OS=Escherichia coli O8 (strain IAI1) GN=argH PE=3 SV=1 12 458 2.0E-126
sp|B7LA60|ARLY_ECO55 Argininosuccinate lyase OS=Escherichia coli (strain 55989 / EAEC) GN=argH PE=3 SV=1 12 458 2.0E-126
sp|A7ZUH8|ARLY_ECO24 Argininosuccinate lyase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=argH PE=3 SV=1 12 458 2.0E-126
sp|B2TWF5|ARLY_SHIB3 Argininosuccinate lyase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=argH PE=3 SV=1 12 458 2.0E-126
sp|B5Z062|ARLY_ECO5E Argininosuccinate lyase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=argH PE=3 SV=1 12 465 2.0E-126
sp|B7K2S1|ARLY_CYAP8 Argininosuccinate lyase OS=Cyanothece sp. (strain PCC 8801) GN=argH PE=3 SV=1 13 459 2.0E-126
sp|P57909|ARLY_PASMU Argininosuccinate lyase OS=Pasteurella multocida (strain Pm70) GN=argH PE=3 SV=1 12 458 3.0E-126
sp|A3DBU0|ARLY_CLOTH Argininosuccinate lyase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=argH PE=3 SV=1 12 458 3.0E-126
sp|Q3YV16|ARLY_SHISS Argininosuccinate lyase OS=Shigella sonnei (strain Ss046) GN=argH PE=3 SV=1 12 458 3.0E-126
sp|Q2RG68|ARLY_MOOTA Argininosuccinate lyase OS=Moorella thermoacetica (strain ATCC 39073) GN=argH PE=3 SV=1 12 465 4.0E-126
sp|Q31U28|ARLY_SHIBS Argininosuccinate lyase OS=Shigella boydii serotype 4 (strain Sb227) GN=argH PE=3 SV=1 12 458 4.0E-126
sp|A7ML84|ARLY_CROS8 Argininosuccinate lyase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=argH PE=3 SV=1 12 458 6.0E-126
sp|B2V6Y7|ARLY_SULSY Argininosuccinate lyase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=argH PE=3 SV=1 9 458 6.0E-126
sp|B7UNT6|ARLY_ECO27 Argininosuccinate lyase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=argH PE=3 SV=1 12 458 8.0E-126
sp|B5F0U9|ARLY_SALA4 Argininosuccinate lyase OS=Salmonella agona (strain SL483) GN=argH PE=3 SV=1 12 458 8.0E-126
sp|O67383|ARLY_AQUAE Argininosuccinate lyase OS=Aquifex aeolicus (strain VF5) GN=argH PE=3 SV=1 13 462 8.0E-126
sp|A5D4Y2|ARLY_PELTS Argininosuccinate lyase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=argH PE=3 SV=1 12 465 8.0E-126
sp|A9MHH3|ARLY_SALAR Argininosuccinate lyase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=argH PE=3 SV=1 12 458 1.0E-125
sp|Q1R3V1|ARLY_ECOUT Argininosuccinate lyase OS=Escherichia coli (strain UTI89 / UPEC) GN=argH PE=3 SV=1 12 458 1.0E-125
sp|Q8FB96|ARLY_ECOL6 Argininosuccinate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argH PE=3 SV=1 12 458 1.0E-125
sp|Q0TAA0|ARLY_ECOL5 Argininosuccinate lyase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=argH PE=3 SV=1 12 458 1.0E-125
sp|A1AID8|ARLY_ECOK1 Argininosuccinate lyase OS=Escherichia coli O1:K1 / APEC GN=argH PE=3 SV=1 12 458 1.0E-125
sp|B7MR51|ARLY_ECO81 Argininosuccinate lyase OS=Escherichia coli O81 (strain ED1a) GN=argH PE=3 SV=1 12 458 1.0E-125
sp|B7MI96|ARLY_ECO45 Argininosuccinate lyase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=argH PE=3 SV=1 12 458 1.0E-125
sp|Q30S87|ARLY_SULDN Argininosuccinate lyase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=argH PE=3 SV=1 12 465 1.0E-125
sp|A3N1I1|ARLY_ACTP2 Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=argH PE=3 SV=1 12 462 1.0E-125
sp|Q3A9W6|ARLY_CARHZ Argininosuccinate lyase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=argH PE=3 SV=1 12 465 2.0E-125
sp|Q929S8|ARLY_LISIN Argininosuccinate lyase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argH PE=3 SV=1 12 460 2.0E-125
sp|A9BIA3|ARLY_PETMO Argininosuccinate lyase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=argH PE=3 SV=1 12 448 2.0E-125
sp|B1M509|ARLY_METRJ Argininosuccinate lyase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=argH PE=3 SV=1 10 457 2.0E-125
sp|A5UHW3|ARLY_HAEIG Argininosuccinate lyase OS=Haemophilus influenzae (strain PittGG) GN=argH PE=3 SV=1 12 458 2.0E-125
sp|A8GL81|ARLY_SERP5 Argininosuccinate lyase OS=Serratia proteamaculans (strain 568) GN=argH PE=3 SV=1 12 465 2.0E-125
sp|A6TGE4|ARLY_KLEP7 Argininosuccinate lyase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=argH PE=3 SV=1 12 458 2.0E-125
sp|A9IZG7|ARLY_BART1 Argininosuccinate lyase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=argH PE=3 SV=1 10 458 2.0E-125
sp|C0Q476|ARLY_SALPC Argininosuccinate lyase OS=Salmonella paratyphi C (strain RKS4594) GN=argH PE=3 SV=1 12 458 2.0E-125
sp|Q57H93|ARLY_SALCH Argininosuccinate lyase OS=Salmonella choleraesuis (strain SC-B67) GN=argH PE=3 SV=1 12 458 2.0E-125
sp|A5UDR3|ARLY_HAEIE Argininosuccinate lyase OS=Haemophilus influenzae (strain PittEE) GN=argH PE=3 SV=1 12 458 2.0E-125
sp|Q8X730|ARLY_ECO57 Argininosuccinate lyase OS=Escherichia coli O157:H7 GN=argH PE=3 SV=1 12 454 2.0E-125
sp|Q28V48|ARLY_JANSC Argininosuccinate lyase OS=Jannaschia sp. (strain CCS1) GN=argH PE=3 SV=1 10 465 2.0E-125
sp|A9N0H0|ARLY_SALPB Argininosuccinate lyase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=argH PE=3 SV=1 12 458 3.0E-125
sp|B3GY67|ARLY_ACTP7 Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=argH PE=3 SV=1 12 462 3.0E-125
sp|B0BQC2|ARLY_ACTPJ Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=argH PE=3 SV=1 12 462 4.0E-125
sp|Q2LT96|ARLY_SYNAS Argininosuccinate lyase OS=Syntrophus aciditrophicus (strain SB) GN=argH PE=3 SV=1 4 463 5.0E-125
sp|B5BJN4|ARLY_SALPK Argininosuccinate lyase OS=Salmonella paratyphi A (strain AKU_12601) GN=argH PE=3 SV=1 12 458 6.0E-125
sp|Q5PK73|ARLY_SALPA Argininosuccinate lyase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=argH PE=3 SV=1 12 458 6.0E-125
sp|Q8ZKL6|ARLY_SALTY Argininosuccinate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argH PE=3 SV=1 12 458 6.0E-125
sp|Q8Y5H1|ARLY_LISMO Argininosuccinate lyase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argH PE=3 SV=1 12 460 6.0E-125
sp|B1JQ59|ARLY_YERPY Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=argH PE=3 SV=1 12 458 7.0E-125
sp|Q0TTA6|ARLY_CLOP1 Argininosuccinate lyase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=argH PE=3 SV=1 12 465 7.0E-125
sp|B4TCQ6|ARLY_SALHS Argininosuccinate lyase OS=Salmonella heidelberg (strain SL476) GN=argH PE=3 SV=1 12 458 8.0E-125
sp|B4T0X1|ARLY_SALNS Argininosuccinate lyase OS=Salmonella newport (strain SL254) GN=argH PE=3 SV=1 12 458 8.0E-125
sp|A8AKW2|ARLY_CITK8 Argininosuccinate lyase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=argH PE=3 SV=1 12 458 8.0E-125
sp|B5RF45|ARLY_SALG2 Argininosuccinate lyase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=argH PE=3 SV=1 12 458 9.0E-125
sp|B5QXQ5|ARLY_SALEP Argininosuccinate lyase OS=Salmonella enteritidis PT4 (strain P125109) GN=argH PE=3 SV=1 12 458 9.0E-125
sp|B5FPX5|ARLY_SALDC Argininosuccinate lyase OS=Salmonella dublin (strain CT_02021853) GN=argH PE=3 SV=1 12 458 9.0E-125
sp|C1KX44|ARLY_LISMC Argininosuccinate lyase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=argH PE=3 SV=1 12 460 1.0E-124
sp|B8DH27|ARLY_LISMH Argininosuccinate lyase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=argH PE=3 SV=1 12 460 1.0E-124
sp|Q4QM89|ARLY_HAEI8 Argininosuccinate lyase OS=Haemophilus influenzae (strain 86-028NP) GN=argH PE=3 SV=1 12 458 1.0E-124
sp|Q2JXY9|ARLY_SYNJA Argininosuccinate lyase OS=Synechococcus sp. (strain JA-3-3Ab) GN=argH PE=3 SV=1 1 459 1.0E-124
sp|Q2NQZ1|ARLY_SODGM Argininosuccinate lyase OS=Sodalis glossinidius (strain morsitans) GN=argH PE=3 SV=1 12 458 1.0E-124
sp|Q7VME5|ARLY_HAEDU Argininosuccinate lyase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=argH PE=3 SV=1 12 465 1.0E-124
sp|Q72GZ4|ARLY_THET2 Argininosuccinate lyase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argH PE=3 SV=1 13 458 1.0E-124
sp|Q2SQ67|ARLY_HAHCH Argininosuccinate lyase OS=Hahella chejuensis (strain KCTC 2396) GN=argH PE=3 SV=1 12 465 2.0E-124
sp|P44314|ARLY_HAEIN Argininosuccinate lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=argH PE=3 SV=1 12 458 2.0E-124
sp|B1X082|ARLY_CYAA5 Argininosuccinate lyase OS=Cyanothece sp. (strain ATCC 51142) GN=argH PE=3 SV=1 13 466 3.0E-124
sp|B4TQH6|ARLY_SALSV Argininosuccinate lyase OS=Salmonella schwarzengrund (strain CVM19633) GN=argH PE=3 SV=1 12 458 3.0E-124
sp|Q2RXE3|ARLY_RHORT Argininosuccinate lyase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=argH PE=3 SV=1 10 454 4.0E-124
sp|Q66G70|ARLY_YERPS Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argH PE=3 SV=1 12 458 4.0E-124
sp|B2JZE4|ARLY_YERPB Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=argH PE=3 SV=1 12 458 4.0E-124
sp|A4TRH3|ARLY_YERPP Argininosuccinate lyase OS=Yersinia pestis (strain Pestoides F) GN=argH PE=3 SV=1 12 458 4.0E-124
sp|Q1CNQ3|ARLY_YERPN Argininosuccinate lyase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=argH PE=3 SV=1 12 458 4.0E-124
sp|A9R514|ARLY_YERPG Argininosuccinate lyase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=argH PE=3 SV=1 12 458 4.0E-124
sp|Q8ZA88|ARLY_YERPE Argininosuccinate lyase OS=Yersinia pestis GN=argH PE=3 SV=1 12 458 4.0E-124
sp|Q1CBV4|ARLY_YERPA Argininosuccinate lyase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=argH PE=3 SV=1 12 458 4.0E-124
sp|A7FD01|ARLY_YERP3 Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=argH PE=3 SV=1 12 458 4.0E-124
sp|Q5SLL0|ARLY_THET8 Argininosuccinate lyase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=argH PE=1 SV=1 13 458 4.0E-124
sp|Q5KW95|ARLY_GEOKA Argininosuccinate lyase OS=Geobacillus kaustophilus (strain HTA426) GN=argH PE=3 SV=2 12 454 5.0E-124
sp|Q71XS3|ARLY_LISMF Argininosuccinate lyase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argH PE=3 SV=1 12 460 5.0E-124
sp|A4SIM6|ARLY_AERS4 Argininosuccinate lyase OS=Aeromonas salmonicida (strain A449) GN=argH PE=3 SV=1 12 454 6.0E-124
sp|A2BZB5|ARLY_PROM1 Argininosuccinate lyase OS=Prochlorococcus marinus (strain NATL1A) GN=argH PE=3 SV=1 13 465 6.0E-124
sp|Q8XMJ8|ARLY_CLOPE Argininosuccinate lyase OS=Clostridium perfringens (strain 13 / Type A) GN=argH PE=3 SV=1 12 465 6.0E-124
sp|Q7M938|ARLY_WOLSU Argininosuccinate lyase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argH PE=3 SV=1 12 461 7.0E-124
sp|Q46104|ARLY_CAMJE Argininosuccinate lyase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=argH PE=3 SV=2 10 462 7.0E-124
sp|Q46I50|ARLY_PROMT Argininosuccinate lyase OS=Prochlorococcus marinus (strain NATL2A) GN=argH PE=3 SV=1 13 465 8.0E-124
sp|A1JI24|ARLY_YERE8 Argininosuccinate lyase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=argH PE=3 SV=1 12 458 8.0E-124
sp|B5XZ16|ARLY_KLEP3 Argininosuccinate lyase OS=Klebsiella pneumoniae (strain 342) GN=argH PE=3 SV=1 12 458 9.0E-124
sp|A0KFV4|ARLY_AERHH Argininosuccinate lyase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=argH PE=3 SV=1 12 454 2.0E-123
sp|C4L7S8|ARLY_TOLAT Argininosuccinate lyase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=argH PE=3 SV=1 12 454 2.0E-123
sp|Q5HUM8|ARLY_CAMJR Argininosuccinate lyase OS=Campylobacter jejuni (strain RM1221) GN=argH PE=3 SV=1 10 461 2.0E-123
sp|Q0A574|ARLY_ALKEH Argininosuccinate lyase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=argH PE=3 SV=1 6 465 2.0E-123
sp|A8AUN7|ARLY_STRGC Argininosuccinate lyase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=argH PE=3 SV=1 8 459 2.0E-123
sp|B4F1G9|ARLY_PROMH Argininosuccinate lyase OS=Proteus mirabilis (strain HI4320) GN=argH PE=3 SV=1 12 466 3.0E-123
sp|A3CQQ3|ARLY_STRSV Argininosuccinate lyase OS=Streptococcus sanguinis (strain SK36) GN=argH PE=3 SV=1 9 466 3.0E-123
sp|Q8Z311|ARLY_SALTI Argininosuccinate lyase OS=Salmonella typhi GN=argH PE=3 SV=1 12 458 3.0E-123
sp|A7H3C0|ARLY_CAMJD Argininosuccinate lyase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=argH PE=3 SV=1 10 465 4.0E-123
sp|B7K8U6|ARLY_CYAP7 Argininosuccinate lyase OS=Cyanothece sp. (strain PCC 7424) GN=argH PE=3 SV=1 13 466 5.0E-123
sp|Q03W71|ARLY_LEUMM Argininosuccinate lyase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=argH PE=3 SV=1 12 458 6.0E-123
sp|A1AX52|ARLY_RUTMC Argininosuccinate lyase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=argH PE=3 SV=1 10 465 8.0E-123
sp|Q5WED9|ARLY2_BACSK Argininosuccinate lyase 2 OS=Bacillus clausii (strain KSM-K16) GN=argH2 PE=3 SV=1 12 460 8.0E-123
sp|P59617|ARLY_LACPL Argininosuccinate lyase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argH PE=3 SV=1 12 459 1.0E-122
sp|Q0I2U1|ARLY_HAES1 Argininosuccinate lyase OS=Haemophilus somnus (strain 129Pt) GN=argH PE=3 SV=1 12 458 2.0E-122
sp|Q7VFF8|ARLY_HELHP Argininosuccinate lyase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=argH PE=3 SV=1 12 465 2.0E-122
sp|Q033U6|ARLY_LACC3 Argininosuccinate lyase OS=Lactobacillus casei (strain ATCC 334) GN=argH PE=3 SV=1 12 465 3.0E-122
sp|B1ZKR9|ARLY_METPB Argininosuccinate lyase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=argH PE=3 SV=1 10 457 4.0E-122
sp|B9DVV8|ARLY_STRU0 Argininosuccinate lyase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=argH PE=3 SV=1 8 462 4.0E-122
sp|A9B9L0|ARLY_PROM4 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9211) GN=argH PE=3 SV=1 13 458 5.0E-122
sp|C1DJ48|ARLY_AZOVD Argininosuccinate lyase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=argH PE=3 SV=1 10 465 5.0E-122
sp|A8LL46|ARLY_DINSH Argininosuccinate lyase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=argH PE=3 SV=1 10 458 5.0E-122
sp|Q9Z660|ARLY_ZYMMO Argininosuccinate lyase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=argH PE=3 SV=2 1 458 5.0E-122
sp|Q7MYD9|ARLY_PHOLL Argininosuccinate lyase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argH PE=3 SV=1 12 458 6.0E-122
sp|P73257|ARLY_SYNY3 Argininosuccinate lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argH PE=3 SV=1 13 460 6.0E-122
sp|A4XNY5|ARLY_PSEMY Argininosuccinate lyase OS=Pseudomonas mendocina (strain ymp) GN=argH PE=3 SV=1 10 465 7.0E-122
sp|Q9K821|ARLY_BACHD Argininosuccinate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argH PE=3 SV=1 12 458 9.0E-122
sp|B0UTI4|ARLY_HISS2 Argininosuccinate lyase OS=Histophilus somni (strain 2336) GN=argH PE=3 SV=1 12 458 9.0E-122
sp|C3K426|ARLY_PSEFS Argininosuccinate lyase OS=Pseudomonas fluorescens (strain SBW25) GN=argH PE=3 SV=1 10 454 1.0E-121
sp|Q5FPK5|ARLY_GLUOX Argininosuccinate lyase OS=Gluconobacter oxydans (strain 621H) GN=argH PE=3 SV=1 10 457 1.0E-121
sp|A7IG40|ARLY_XANP2 Argininosuccinate lyase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=argH PE=3 SV=1 10 459 1.0E-121
sp|Q65W16|ARLY_MANSM Argininosuccinate lyase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=argH PE=3 SV=1 12 458 1.0E-121
sp|B2VGA9|ARLY_ERWT9 Argininosuccinate lyase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=argH PE=3 SV=1 12 458 2.0E-121
sp|B0JXI2|ARLY_MICAN Argininosuccinate lyase OS=Microcystis aeruginosa (strain NIES-843) GN=argH PE=3 SV=1 13 466 2.0E-121
sp|Q88B94|ARLY_PSESM Argininosuccinate lyase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argH PE=3 SV=1 10 454 2.0E-121
sp|A9HRH6|ARLY_GLUDA Argininosuccinate lyase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=argH PE=3 SV=1 10 457 3.0E-121
sp|A0Q1Z1|ARLY_CLONN Argininosuccinate lyase OS=Clostridium novyi (strain NT) GN=argH PE=3 SV=1 12 442 4.0E-121
sp|A8FLY0|ARLY_CAMJ8 Argininosuccinate lyase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=argH PE=3 SV=1 10 462 4.0E-121
sp|A4WG51|ARLY_ENT38 Argininosuccinate lyase OS=Enterobacter sp. (strain 638) GN=argH PE=3 SV=1 12 458 4.0E-121
sp|B2G6Y7|ARLY_LACRJ Argininosuccinate lyase OS=Lactobacillus reuteri (strain JCM 1112) GN=argH PE=3 SV=1 12 466 4.0E-121
sp|A5VJH2|ARLY_LACRD Argininosuccinate lyase OS=Lactobacillus reuteri (strain DSM 20016) GN=argH PE=3 SV=1 12 466 4.0E-121
sp|B2UYI1|ARLY_CLOBA Argininosuccinate lyase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=argH PE=3 SV=1 12 465 5.0E-121
sp|A9W714|ARLY_METEP Argininosuccinate lyase OS=Methylobacterium extorquens (strain PA1) GN=argH PE=3 SV=1 10 457 5.0E-121
sp|A1VZR4|ARLY_CAMJJ Argininosuccinate lyase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=argH PE=3 SV=1 10 462 5.0E-121
sp|Q8DLW0|ARLY_THEEB Argininosuccinate lyase OS=Thermosynechococcus elongatus (strain BP-1) GN=argH PE=3 SV=1 13 466 6.0E-121
sp|B7KW75|ARLY_METC4 Argininosuccinate lyase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=argH PE=3 SV=1 10 457 6.0E-121
sp|B2TQ24|ARLY_CLOBB Argininosuccinate lyase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=argH PE=3 SV=1 12 465 8.0E-121
sp|Q48QD3|ARLY_PSE14 Argininosuccinate lyase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=argH PE=3 SV=1 10 454 1.0E-120
sp|A1S265|ARLY_SHEAM Argininosuccinate lyase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=argH PE=3 SV=1 12 454 1.0E-120
sp|Q8GIS1|ARLY_SYNE7 Argininosuccinate lyase OS=Synechococcus elongatus (strain PCC 7942) GN=argH PE=3 SV=1 13 466 1.0E-120
sp|A2RHL0|ARLY_LACLM Argininosuccinate lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=argH PE=3 SV=1 12 458 2.0E-120
sp|A8GZ22|ARLY_SHEPA Argininosuccinate lyase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=argH PE=3 SV=1 12 454 2.0E-120
sp|Q20WT9|ARLY_RHOPB Argininosuccinate lyase OS=Rhodopseudomonas palustris (strain BisB18) GN=argH PE=3 SV=2 10 460 2.0E-120
sp|C4Z0V2|ARLY_EUBE2 Argininosuccinate lyase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=argH PE=3 SV=1 12 463 2.0E-120
sp|Q500N3|ARLY_PSEU2 Argininosuccinate lyase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=argH PE=3 SV=1 10 454 2.0E-120
sp|B0TL84|ARLY_SHEHH Argininosuccinate lyase OS=Shewanella halifaxensis (strain HAW-EB4) GN=argH PE=3 SV=1 12 460 3.0E-120
sp|Q9LAE5|ARLY_NOSP7 Argininosuccinate lyase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=argH PE=3 SV=2 13 466 3.0E-120
sp|Q032X5|ARLY_LACLS Argininosuccinate lyase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=argH PE=3 SV=1 12 458 3.0E-120
sp|B8CNI1|ARLY_SHEPW Argininosuccinate lyase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=argH PE=3 SV=1 12 454 3.0E-120
sp|Q1QHU1|ARLY_NITHX Argininosuccinate lyase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=argH PE=3 SV=1 10 457 3.0E-120
sp|B8GSV2|ARLY_THISH Argininosuccinate lyase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=argH PE=3 SV=1 3 454 4.0E-120
sp|B8F531|ARLY_HAEPS Argininosuccinate lyase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=argH PE=3 SV=1 12 466 5.0E-120
sp|B1MZP3|ARLY_LEUCK Argininosuccinate lyase OS=Leuconostoc citreum (strain KM20) GN=argH PE=3 SV=1 12 458 5.0E-120
sp|A5VAA0|ARLY_SPHWW Argininosuccinate lyase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=argH PE=3 SV=1 12 458 5.0E-120
sp|Q49W99|ARLY_STAS1 Argininosuccinate lyase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=argH PE=3 SV=1 10 465 5.0E-120
sp|B3QCB2|ARLY_RHOPT Argininosuccinate lyase OS=Rhodopseudomonas palustris (strain TIE-1) GN=argH PE=3 SV=1 10 459 6.0E-120
sp|Q6N0L9|ARLY_RHOPA Argininosuccinate lyase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=argH PE=3 SV=1 10 459 6.0E-120
sp|Q8YQE6|ARLY_NOSS1 Argininosuccinate lyase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argH PE=3 SV=1 13 462 6.0E-120
sp|Q2G4W0|ARLY_NOVAD Argininosuccinate lyase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=argH PE=3 SV=1 1 462 6.0E-120
sp|A0AKJ8|ARLY_LISW6 Argininosuccinate lyase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=argH PE=3 SV=1 12 460 7.0E-120
sp|Q5N1K1|ARLY_SYNP6 Argininosuccinate lyase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argH PE=3 SV=1 13 466 1.0E-119
sp|P57159|ARLY_BUCAI Argininosuccinate lyase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argH PE=3 SV=1 12 458 1.0E-119
sp|Q3MC57|ARLY_ANAVT Argininosuccinate lyase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=argH PE=3 SV=1 9 463 1.0E-119
sp|A4VGX6|ARLY_PSEU5 Argininosuccinate lyase OS=Pseudomonas stutzeri (strain A1501) GN=argH PE=3 SV=1 10 459 2.0E-119
sp|P50987|ARLY_PSEAE Argininosuccinate lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argH PE=3 SV=2 10 465 2.0E-119
sp|Q02EA0|ARLY_PSEAB Argininosuccinate lyase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=argH PE=3 SV=1 10 465 2.0E-119
sp|A4YBT8|ARLY_SHEPC Argininosuccinate lyase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=argH PE=3 SV=1 12 458 2.0E-119
sp|Q3ZYF9|ARLY_DEHMC Argininosuccinate lyase OS=Dehalococcoides mccartyi (strain CBDB1) GN=argH PE=3 SV=1 16 465 2.0E-119
sp|Q97KE5|ARLY_CLOAB Argininosuccinate lyase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argH PE=3 SV=1 12 446 2.0E-119
sp|Q9L1B1|ARLY_STRCO Argininosuccinate lyase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argH PE=3 SV=1 1 458 3.0E-119
sp|Q3ASM4|ARLY_CHLCH Argininosuccinate lyase OS=Chlorobium chlorochromatii (strain CaD3) GN=argH PE=3 SV=1 5 463 3.0E-119
sp|A3DA22|ARLY_SHEB5 Argininosuccinate lyase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=argH PE=3 SV=1 12 458 3.0E-119
sp|A9KTY6|ARLY_SHEB9 Argininosuccinate lyase OS=Shewanella baltica (strain OS195) GN=argH PE=3 SV=1 12 458 4.0E-119
sp|C3LRV2|ARLY_VIBCM Argininosuccinate lyase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=argH PE=3 SV=1 12 459 4.0E-119
sp|Q9KNT9|ARLY_VIBCH Argininosuccinate lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argH PE=3 SV=1 12 459 4.0E-119
sp|A5F4Z3|ARLY_VIBC3 Argininosuccinate lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=argH PE=3 SV=1 12 459 4.0E-119
sp|B7V5F3|ARLY_PSEA8 Argininosuccinate lyase OS=Pseudomonas aeruginosa (strain LESB58) GN=argH PE=3 SV=1 10 465 5.0E-119
sp|Q8KA59|ARLY_BUCAP Argininosuccinate lyase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argH PE=3 SV=1 12 458 5.0E-119
sp|Q3K4S8|ARLY2_PSEPF Argininosuccinate lyase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=argH2 PE=3 SV=1 10 454 6.0E-119
sp|Q4JVZ7|ARLY_CORJK Argininosuccinate lyase OS=Corynebacterium jeikeium (strain K411) GN=argH PE=3 SV=1 9 457 7.0E-119
sp|Q3JDS2|ARLY_NITOC Argininosuccinate lyase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=argH PE=3 SV=1 13 466 8.0E-119
sp|A1RPR5|ARLY_SHESW Argininosuccinate lyase OS=Shewanella sp. (strain W3-18-1) GN=argH PE=3 SV=1 12 458 9.0E-119
sp|B1W3B4|ARLY_STRGG Argininosuccinate lyase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=argH PE=3 SV=1 1 465 9.0E-119
sp|B1J1V0|ARLY_PSEPW Argininosuccinate lyase OS=Pseudomonas putida (strain W619) GN=argH PE=3 SV=1 10 458 9.0E-119
sp|A5FQ74|ARLY_DEHMB Argininosuccinate lyase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=argH PE=3 SV=1 16 465 9.0E-119
sp|Q4K3X1|ARLY_PSEF5 Argininosuccinate lyase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=argH PE=3 SV=1 10 454 9.0E-119
sp|Q1GXA9|ARLY_METFK Argininosuccinate lyase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=argH PE=3 SV=1 13 465 1.0E-118
sp|Q12SM6|ARLY_SHEDO Argininosuccinate lyase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=argH PE=3 SV=1 12 460 1.0E-118
sp|A6VKY5|ARLY_ACTSZ Argininosuccinate lyase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=argH PE=3 SV=1 12 458 1.0E-118
sp|A6VE40|ARLY_PSEA7 Argininosuccinate lyase OS=Pseudomonas aeruginosa (strain PA7) GN=argH PE=3 SV=1 10 465 2.0E-118
sp|C6DI79|ARLY_PECCP Argininosuccinate lyase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=argH PE=3 SV=1 12 458 2.0E-118
sp|Q5HBZ4|ARLY_EHRRW Argininosuccinate lyase OS=Ehrlichia ruminantium (strain Welgevonden) GN=argH PE=3 SV=1 10 459 2.0E-118
sp|B1Y070|ARLY_LEPCP Argininosuccinate lyase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=argH PE=3 SV=1 1 458 2.0E-118
sp|Q3Z726|ARLY_DEHM1 Argininosuccinate lyase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=argH PE=3 SV=1 16 465 2.0E-118
sp|B8EPF2|ARLY_METSB Argininosuccinate lyase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=argH PE=3 SV=1 10 457 2.0E-118
sp|Q82TN0|ARLY_NITEU Argininosuccinate lyase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argH PE=3 SV=1 9 465 2.0E-118
sp|Q1I314|ARLY_PSEE4 Argininosuccinate lyase OS=Pseudomonas entomophila (strain L48) GN=argH PE=3 SV=1 10 454 2.0E-118
sp|B0KH03|ARLY_PSEPG Argininosuccinate lyase OS=Pseudomonas putida (strain GB-1) GN=argH PE=3 SV=1 10 454 3.0E-118
sp|Q47N85|ARLY_THEFY Argininosuccinate lyase OS=Thermobifida fusca (strain YX) GN=argH PE=3 SV=1 12 466 3.0E-118
sp|P59618|ARLY_PSEPK Argininosuccinate lyase OS=Pseudomonas putida (strain KT2440) GN=argH PE=3 SV=2 10 454 3.0E-118
sp|Q5FA15|ARLY_NEIG1 Argininosuccinate lyase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=argH PE=3 SV=1 13 464 3.0E-118
sp|Q2GFQ7|ARLY_EHRCR Argininosuccinate lyase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=argH PE=3 SV=1 10 459 3.0E-118
sp|Q827Z0|ARLY_STRAW Argininosuccinate lyase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argH PE=3 SV=1 1 462 4.0E-118
sp|Q0VM25|ARLY_ALCBS Argininosuccinate lyase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=argH PE=3 SV=1 10 450 4.0E-118
sp|Q03IP9|ARLY_STRTD Argininosuccinate lyase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=argH PE=3 SV=1 1 459 4.0E-118
sp|Q5M2K3|ARLY_STRT2 Argininosuccinate lyase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=argH PE=3 SV=2 1 459 4.0E-118
sp|Q5LXZ9|ARLY_STRT1 Argininosuccinate lyase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=argH PE=3 SV=2 1 459 4.0E-118
sp|Q2L1J6|ARLY_BORA1 Argininosuccinate lyase OS=Bordetella avium (strain 197N) GN=argH PE=3 SV=1 13 457 5.0E-118
sp|Q3YSS4|ARLY_EHRCJ Argininosuccinate lyase OS=Ehrlichia canis (strain Jake) GN=argH PE=3 SV=1 10 459 5.0E-118
sp|Q5FH83|ARLY_EHRRG Argininosuccinate lyase OS=Ehrlichia ruminantium (strain Gardel) GN=argH PE=3 SV=1 10 459 5.0E-118
sp|Q2JJY4|ARLY_SYNJB Argininosuccinate lyase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=argH PE=3 SV=1 13 459 6.0E-118
sp|C4L2P3|ARLY_EXISA Argininosuccinate lyase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=argH PE=3 SV=1 12 459 6.0E-118
sp|Q9K3D7|ARGHA_MORPR Bifunctional protein ArgHA (Fragment) OS=Moritella profunda GN=argHA PE=3 SV=1 12 454 6.0E-118
sp|B8ILR2|ARLY_METNO Argininosuccinate lyase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=argH PE=3 SV=1 10 457 7.0E-118
sp|A5N6U3|ARLY_CLOK5 Argininosuccinate lyase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=argH PE=3 SV=1 12 447 8.0E-118
sp|B9E0B2|ARLY_CLOK1 Argininosuccinate lyase OS=Clostridium kluyveri (strain NBRC 12016) GN=argH PE=3 SV=1 12 447 8.0E-118
sp|Q0AM30|ARLY_MARMM Argininosuccinate lyase OS=Maricaulis maris (strain MCS10) GN=argH PE=3 SV=1 10 465 8.0E-118
sp|Q13CL5|ARLY_RHOPS Argininosuccinate lyase OS=Rhodopseudomonas palustris (strain BisB5) GN=argH PE=3 SV=1 10 459 9.0E-118
sp|Q9CJ76|ARLY_LACLA Argininosuccinate lyase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argH PE=3 SV=1 12 458 1.0E-117
sp|B9EAN2|ARLY_MACCJ Argininosuccinate lyase OS=Macrococcus caseolyticus (strain JCSC5402) GN=argH PE=3 SV=1 12 458 1.0E-117
sp|B2GE78|ARLY_LACF3 Argininosuccinate lyase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=argH PE=3 SV=1 12 465 2.0E-117
sp|Q7VVG6|ARLY_BORPE Argininosuccinate lyase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argH PE=3 SV=1 13 461 2.0E-117
sp|Q7WAE4|ARLY_BORPA Argininosuccinate lyase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argH PE=3 SV=2 13 461 2.0E-117
sp|Q7WJI7|ARLY_BORBR Argininosuccinate lyase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argH PE=3 SV=1 13 461 2.0E-117
sp|B0CEZ5|ARLY_ACAM1 Argininosuccinate lyase OS=Acaryochloris marina (strain MBIC 11017) GN=argH PE=3 SV=1 3 461 2.0E-117
sp|Q7VEK0|ARLY_PROMA Argininosuccinate lyase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argH PE=3 SV=1 13 465 3.0E-117
sp|A9KQ51|ARLY_CLOPH Argininosuccinate lyase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=argH PE=3 SV=1 12 459 3.0E-117
sp|Q6DAQ9|ARLY_PECAS Argininosuccinate lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argH PE=3 SV=1 12 458 3.0E-117
sp|Q3B426|ARLY_CHLL7 Argininosuccinate lyase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=argH PE=3 SV=1 3 465 6.0E-117
sp|Q1QSV4|ARLY_CHRSD Argininosuccinate lyase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=argH PE=3 SV=1 10 454 6.0E-117
sp|Q6FFB2|ARLY_ACIAD Argininosuccinate lyase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=argH PE=3 SV=1 12 466 7.0E-117
sp|C5CRT0|ARLY_VARPS Argininosuccinate lyase OS=Variovorax paradoxus (strain S110) GN=argH PE=3 SV=1 1 458 7.0E-117
sp|A0LE33|ARLY_MAGMM Argininosuccinate lyase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=argH PE=3 SV=1 3 465 1.0E-116
sp|B1IK07|ARLY_CLOBK Argininosuccinate lyase OS=Clostridium botulinum (strain Okra / Type B1) GN=argH PE=3 SV=1 12 442 1.0E-116
sp|Q3SUR0|ARLY_NITWN Argininosuccinate lyase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=argH PE=3 SV=1 10 459 1.0E-116
sp|Q8E271|ARLY_STRA5 Argininosuccinate lyase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=argH PE=3 SV=1 9 465 1.0E-116
sp|P59613|ARLY_BRADU Argininosuccinate lyase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argH PE=3 SV=1 10 459 1.0E-116
sp|A4VXZ3|ARLY_STRSY Argininosuccinate lyase OS=Streptococcus suis (strain 05ZYH33) GN=argH PE=3 SV=1 12 463 2.0E-116
sp|A4W487|ARLY_STRS2 Argininosuccinate lyase OS=Streptococcus suis (strain 98HAH33) GN=argH PE=3 SV=1 12 463 2.0E-116
sp|B4U6T9|ARLY_HYDS0 Argininosuccinate lyase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=argH PE=3 SV=1 13 458 2.0E-116
sp|Q6NHG4|ARLY_CORDI Argininosuccinate lyase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=argH PE=3 SV=1 9 457 2.0E-116
sp|A1KSP4|ARLY_NEIMF Argininosuccinate lyase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=argH PE=3 SV=1 13 465 3.0E-116
sp|Q8E7N0|ARLY_STRA3 Argininosuccinate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=argH PE=3 SV=1 9 465 3.0E-116
sp|A8G1A3|ARLY_SHESH Argininosuccinate lyase OS=Shewanella sediminis (strain HAW-EB3) GN=argH PE=3 SV=1 12 454 3.0E-116
sp|A2SET3|ARLY_METPP Argininosuccinate lyase OS=Methylibium petroleiphilum (strain PM1) GN=argH PE=3 SV=1 13 458 3.0E-116
sp|Q3K3Q3|ARLY_STRA1 Argininosuccinate lyase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=argH PE=3 SV=1 9 465 4.0E-116
sp|Q9JVG7|ARLY_NEIMA Argininosuccinate lyase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argH PE=3 SV=1 13 464 4.0E-116
sp|Q0HDU9|ARLY_SHESM Argininosuccinate lyase OS=Shewanella sp. (strain MR-4) GN=argH PE=3 SV=1 12 458 4.0E-116
sp|Q9K0G8|ARLY_NEIMB Argininosuccinate lyase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argH PE=3 SV=1 13 465 4.0E-116
sp|A9M2R4|ARLY_NEIM0 Argininosuccinate lyase OS=Neisseria meningitidis serogroup C (strain 053442) GN=argH PE=3 SV=1 13 465 4.0E-116
sp|Q1LJQ2|ARLY_CUPMC Argininosuccinate lyase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=argH PE=3 SV=1 13 454 4.0E-116
sp|A7GGQ8|ARLY_CLOBL Argininosuccinate lyase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=argH PE=3 SV=1 12 442 4.0E-116
sp|A4FKC1|ARLY_SACEN Argininosuccinate lyase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=argH PE=3 SV=1 2 457 4.0E-116
sp|P59620|ARLY_VIBPA Bifunctional protein ArgH OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argH PE=3 SV=1 12 454 5.0E-116
sp|B0T2T7|ARLY_CAUSK Argininosuccinate lyase OS=Caulobacter sp. (strain K31) GN=argH PE=3 SV=1 12 465 5.0E-116
sp|A0L250|ARLY_SHESA Argininosuccinate lyase OS=Shewanella sp. (strain ANA-3) GN=argH PE=3 SV=1 12 458 5.0E-116
sp|Q2Y6K2|ARLY_NITMU Argininosuccinate lyase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=argH PE=3 SV=1 2 465 6.0E-116
sp|A4G3U8|ARLY_HERAR Argininosuccinate lyase OS=Herminiimonas arsenicoxydans GN=argH PE=3 SV=1 2 458 7.0E-116
sp|Q7MH73|ARLY_VIBVY Bifunctional protein ArgH OS=Vibrio vulnificus (strain YJ016) GN=argH PE=3 SV=1 12 454 8.0E-116
sp|Q8DCM9|ARLY_VIBVU Bifunctional protein ArgH OS=Vibrio vulnificus (strain CMCP6) GN=argH PE=3 SV=1 12 454 8.0E-116
sp|Q609I6|ARLY_METCA Argininosuccinate lyase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=argH PE=3 SV=1 12 454 9.0E-116
sp|B0VDE4|ARLY_ACIBY Argininosuccinate lyase OS=Acinetobacter baumannii (strain AYE) GN=argH PE=3 SV=1 1 458 1.0E-115
sp|B7I338|ARLY_ACIB5 Argininosuccinate lyase OS=Acinetobacter baumannii (strain AB0057) GN=argH PE=3 SV=1 1 458 1.0E-115
sp|B7H1L9|ARLY_ACIB3 Argininosuccinate lyase OS=Acinetobacter baumannii (strain AB307-0294) GN=argH PE=3 SV=1 1 458 1.0E-115
sp|Q479S1|ARLY_DECAR Argininosuccinate lyase OS=Dechloromonas aromatica (strain RCB) GN=argH PE=3 SV=1 1 450 1.0E-115
sp|A4QDZ5|ARLY_CORGB Argininosuccinate lyase OS=Corynebacterium glutamicum (strain R) GN=argH PE=3 SV=1 9 457 1.0E-115
sp|A3M1E0|ARLY_ACIBT Argininosuccinate lyase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=argH PE=3 SV=2 1 458 1.0E-115
sp|B0VMC7|ARLY_ACIBS Argininosuccinate lyase OS=Acinetobacter baumannii (strain SDF) GN=argH PE=3 SV=1 1 458 1.0E-115
sp|B2I1W9|ARLY_ACIBC Argininosuccinate lyase OS=Acinetobacter baumannii (strain ACICU) GN=argH PE=3 SV=1 1 458 1.0E-115
sp|Q2J867|ARLY_FRASC Argininosuccinate lyase OS=Frankia sp. (strain CcI3) GN=argH PE=3 SV=1 12 466 1.0E-115
sp|Q21EF4|ARLY_SACD2 Argininosuccinate lyase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=argH PE=3 SV=1 13 454 1.0E-115
sp|Q1IWM5|ARLY_DEIGD Argininosuccinate lyase OS=Deinococcus geothermalis (strain DSM 11300) GN=argH PE=3 SV=1 9 465 1.0E-115
sp|Q8EK27|ARLY_SHEON Argininosuccinate lyase OS=Shewanella oneidensis (strain MR-1) GN=argH PE=3 SV=1 12 458 2.0E-115
sp|Q9A683|ARLY_CAUCR Argininosuccinate lyase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argH PE=3 SV=2 12 465 2.0E-115
sp|Q182I5|ARLY_PEPD6 Argininosuccinate lyase OS=Peptoclostridium difficile (strain 630) GN=argH PE=3 SV=2 12 442 2.0E-115
sp|C1FU67|ARLY_CLOBJ Argininosuccinate lyase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=argH PE=3 SV=1 12 442 2.0E-115
sp|P59614|ARLY_BUCBP Argininosuccinate lyase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=argH PE=3 SV=1 12 458 2.0E-115
sp|Q31JG7|ARLY_THICR Argininosuccinate lyase OS=Thiomicrospira crunogena (strain XCL-2) GN=argH PE=3 SV=1 12 465 3.0E-115
sp|B4S7P9|ARLY_PROA2 Argininosuccinate lyase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=argH PE=3 SV=1 11 458 3.0E-115
sp|Q0I060|ARLY_SHESR Argininosuccinate lyase OS=Shewanella sp. (strain MR-7) GN=argH PE=3 SV=1 12 458 3.0E-115
sp|A6WTR9|ARLY_SHEB8 Argininosuccinate lyase OS=Shewanella baltica (strain OS185) GN=argH PE=3 SV=1 12 458 5.0E-115
sp|C1D665|ARLY_LARHH Argininosuccinate lyase OS=Laribacter hongkongensis (strain HLHK9) GN=argH PE=3 SV=1 9 458 6.0E-115
sp|P59615|ARLY_BURM1 Argininosuccinate lyase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=argH PE=3 SV=1 13 454 8.0E-115
sp|A5I5A3|ARLY_CLOBH Argininosuccinate lyase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=argH PE=3 SV=1 12 442 8.0E-115
sp|A7FWU5|ARLY_CLOB1 Argininosuccinate lyase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=argH PE=3 SV=1 12 442 8.0E-115
sp|B9DIU3|ARLY_STACT Argininosuccinate lyase OS=Staphylococcus carnosus (strain TM300) GN=argH PE=3 SV=1 10 465 8.0E-115
sp|B8EBF9|ARLY_SHEB2 Argininosuccinate lyase OS=Shewanella baltica (strain OS223) GN=argH PE=3 SV=1 12 458 9.0E-115
sp|O88101|ARLY_CORGL Argininosuccinate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=argH PE=3 SV=2 9 457 1.0E-114
sp|A2BTV0|ARLY_PROM5 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9515) GN=argH PE=3 SV=1 12 460 1.0E-114
sp|Q8CT81|ARLY_STAES Argininosuccinate lyase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argH PE=3 SV=1 10 465 1.0E-114
sp|Q5HQK1|ARLY_STAEQ Argininosuccinate lyase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argH PE=3 SV=1 10 465 1.0E-114
sp|C3L1U2|ARLY_CLOB6 Argininosuccinate lyase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=argH PE=3 SV=1 12 442 1.0E-114
sp|Q2VYN2|ARLY_MAGSA Argininosuccinate lyase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=argH PE=3 SV=1 12 458 1.0E-114
sp|Q8FTM8|ARLY_COREF Argininosuccinate lyase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=argH PE=3 SV=1 9 457 2.0E-114
sp|Q2J1X2|ARLY_RHOP2 Argininosuccinate lyase OS=Rhodopseudomonas palustris (strain HaA2) GN=argH PE=3 SV=1 10 459 2.0E-114
sp|Q7TUI1|ARLY_PROMP Argininosuccinate lyase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argH PE=3 SV=1 12 449 2.0E-114
sp|B1KP64|ARLY_SHEWM Argininosuccinate lyase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=argH PE=3 SV=1 12 454 2.0E-114
sp|A6Q7P5|ARLY_SULNB Argininosuccinate lyase OS=Sulfurovum sp. (strain NBC37-1) GN=argH PE=3 SV=1 12 466 2.0E-114
sp|Q1QEM4|ARLY_PSYCK Argininosuccinate lyase OS=Psychrobacter cryohalolentis (strain K5) GN=argH PE=3 SV=1 12 458 3.0E-114
sp|A5EB50|ARLY_BRASB Argininosuccinate lyase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=argH PE=3 SV=1 10 459 3.0E-114
sp|Q2T079|ARLY_BURTA Argininosuccinate lyase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=argH PE=3 SV=1 13 454 3.0E-114
sp|Q5E2E8|ARLY_VIBF1 Bifunctional protein ArgH OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=argH PE=3 SV=1 12 454 4.0E-114
sp|Q7NLS0|ARLY_GLOVI Argininosuccinate lyase OS=Gloeobacter violaceus (strain PCC 7421) GN=argH PE=3 SV=1 13 459 5.0E-114
sp|A8ESF7|ARLY_ARCB4 Argininosuccinate lyase OS=Arcobacter butzleri (strain RM4018) GN=argH PE=3 SV=1 24 466 6.0E-114
sp|B1KXY0|ARLY_CLOBM Argininosuccinate lyase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=argH PE=3 SV=1 12 442 6.0E-114
sp|Q143B9|ARLY_BURXL Argininosuccinate lyase OS=Burkholderia xenovorans (strain LB400) GN=argH PE=3 SV=1 13 465 6.0E-114
sp|Q8DVX5|ARLY_STRMU Argininosuccinate lyase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argH PE=3 SV=1 9 458 7.0E-114
sp|Q9K3D6|ARGHA_MORAB Bifunctional protein ArgHA OS=Moritella abyssi GN=argHA PE=3 SV=1 12 454 7.0E-114
sp|Q0AGL1|ARLY_NITEC Argininosuccinate lyase OS=Nitrosomonas eutropha (strain C91) GN=argH PE=3 SV=1 9 465 7.0E-114
sp|A5GHM4|ARLY_SYNPW Argininosuccinate lyase OS=Synechococcus sp. (strain WH7803) GN=argH PE=3 SV=1 1 466 8.0E-114
sp|Q2YWS5|ARLY_STAAB Argininosuccinate lyase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=argH PE=3 SV=1 10 465 9.0E-114
sp|Q39DW2|ARLY_BURL3 Argininosuccinate lyase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=argH PE=3 SV=1 13 450 1.0E-113
sp|A1K451|ARLY_AZOSB Argininosuccinate lyase OS=Azoarcus sp. (strain BH72) GN=argH PE=3 SV=1 2 458 1.0E-113
sp|B3ECP3|ARLY_CHLL2 Argininosuccinate lyase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=argH PE=3 SV=1 3 465 2.0E-113
sp|A0LEB1|ARLY_SYNFM Argininosuccinate lyase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=argH PE=3 SV=1 12 466 2.0E-113
sp|Q0IE70|ARLY_SYNS3 Argininosuccinate lyase OS=Synechococcus sp. (strain CC9311) GN=argH PE=3 SV=1 1 460 2.0E-113
sp|Q8NXF3|ARLY_STAAW Argininosuccinate lyase OS=Staphylococcus aureus (strain MW2) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|Q6GAW6|ARLY_STAAS Argininosuccinate lyase OS=Staphylococcus aureus (strain MSSA476) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|Q6GIC8|ARLY_STAAR Argininosuccinate lyase OS=Staphylococcus aureus (strain MRSA252) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|A1V5V1|ARLY_BURMS Argininosuccinate lyase OS=Burkholderia mallei (strain SAVP1) GN=argH PE=3 SV=1 13 454 2.0E-113
sp|Q62LD1|ARLY_BURMA Argininosuccinate lyase OS=Burkholderia mallei (strain ATCC 23344) GN=argH PE=3 SV=1 13 454 2.0E-113
sp|A2SAG6|ARLY_BURM9 Argininosuccinate lyase OS=Burkholderia mallei (strain NCTC 10229) GN=argH PE=3 SV=1 13 454 2.0E-113
sp|A3MLL6|ARLY_BURM7 Argininosuccinate lyase OS=Burkholderia mallei (strain NCTC 10247) GN=argH PE=3 SV=1 13 454 2.0E-113
sp|P63583|ARLY_STAAN Argininosuccinate lyase OS=Staphylococcus aureus (strain N315) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|P63582|ARLY_STAAM Argininosuccinate lyase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|A6QFH1|ARLY_STAAE Argininosuccinate lyase OS=Staphylococcus aureus (strain Newman) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|Q5HHC5|ARLY_STAAC Argininosuccinate lyase OS=Staphylococcus aureus (strain COL) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|A5IRD8|ARLY_STAA9 Argininosuccinate lyase OS=Staphylococcus aureus (strain JH9) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|Q2FZU2|ARLY_STAA8 Argininosuccinate lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|A6U067|ARLY_STAA2 Argininosuccinate lyase OS=Staphylococcus aureus (strain JH1) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|A7X0H4|ARLY_STAA1 Argininosuccinate lyase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=argH PE=3 SV=1 10 465 2.0E-113
sp|A5FWI3|ARLY_ACICJ Argininosuccinate lyase OS=Acidiphilium cryptum (strain JF-5) GN=argH PE=3 SV=1 13 454 3.0E-113
sp|Q4FVJ6|ARLY_PSYA2 Argininosuccinate lyase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=argH PE=3 SV=1 12 458 3.0E-113
sp|A1WB09|ARLY_ACISJ Argininosuccinate lyase OS=Acidovorax sp. (strain JS42) GN=argH PE=3 SV=1 13 458 3.0E-113
sp|B9MDU0|ARLY_ACIET Argininosuccinate lyase OS=Acidovorax ebreus (strain TPSY) GN=argH PE=3 SV=1 13 458 3.0E-113
sp|Q0K7M0|ARLY_CUPNH Argininosuccinate lyase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=argH PE=3 SV=1 13 466 3.0E-113
sp|Q6AR60|ARLY_DESPS Argininosuccinate lyase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=argH PE=3 SV=1 12 458 3.0E-113
sp|B0UJ26|ARLY_METS4 Argininosuccinate lyase OS=Methylobacterium sp. (strain 4-46) GN=argH PE=3 SV=1 10 457 3.0E-113
sp|Q7TV86|ARLY_PROMM Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9313) GN=argH PE=3 SV=1 1 466 3.0E-113
sp|B4E8D2|ARLY_BURCJ Argininosuccinate lyase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=argH PE=3 SV=1 13 450 4.0E-113
sp|A0K9K2|ARLY_BURCH Argininosuccinate lyase OS=Burkholderia cenocepacia (strain HI2424) GN=argH PE=3 SV=1 13 450 4.0E-113
sp|Q1BUI4|ARLY_BURCA Argininosuccinate lyase OS=Burkholderia cenocepacia (strain AU 1054) GN=argH PE=3 SV=1 13 450 4.0E-113
sp|Q7P1U7|ARLY_CHRVO Argininosuccinate lyase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=argH PE=3 SV=1 9 458 5.0E-113
sp|A4Z1S4|ARLY_BRASO Argininosuccinate lyase OS=Bradyrhizobium sp. (strain ORS278) GN=argH PE=3 SV=1 10 459 6.0E-113
sp|A2C5K9|ARLY_PROM3 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9303) GN=argH PE=3 SV=1 1 466 6.0E-113
sp|Q5P7H3|ARLY_AROAE Argininosuccinate lyase OS=Aromatoleum aromaticum (strain EbN1) GN=argH PE=3 SV=1 3 458 7.0E-113
sp|A4JGV8|ARLY_BURVG Argininosuccinate lyase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=argH PE=3 SV=1 13 454 7.0E-113
sp|Q4L4X6|ARLY_STAHJ Argininosuccinate lyase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=argH PE=3 SV=1 13 466 8.0E-113
sp|A1SJJ4|ARLY_NOCSJ Argininosuccinate lyase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=argH PE=3 SV=1 12 466 8.0E-113
sp|B1JWR5|ARLY_BURCC Argininosuccinate lyase OS=Burkholderia cenocepacia (strain MC0-3) GN=argH PE=3 SV=1 13 450 8.0E-113
sp|Q3SM68|ARLY_THIDA Argininosuccinate lyase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=argH PE=3 SV=1 1 452 1.0E-112
sp|A6SX31|ARLY_JANMA Argininosuccinate lyase OS=Janthinobacterium sp. (strain Marseille) GN=argH PE=3 SV=1 13 454 1.0E-112
sp|C1ASZ5|ARLY_RHOOB Argininosuccinate lyase OS=Rhodococcus opacus (strain B4) GN=argH PE=3 SV=1 9 464 2.0E-112
sp|A8Z066|ARLY_STAAT Argininosuccinate lyase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=argH PE=3 SV=1 10 465 2.0E-112
sp|Q2FIB5|ARLY_STAA3 Argininosuccinate lyase OS=Staphylococcus aureus (strain USA300) GN=argH PE=3 SV=1 10 465 2.0E-112
sp|Q8KDJ5|ARLY_CHLTE Argininosuccinate lyase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argH PE=3 SV=1 3 458 2.0E-112
sp|Q474V6|ARLY_CUPPJ Argininosuccinate lyase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=argH PE=3 SV=1 13 454 2.0E-112
sp|B2JEP3|ARLY_BURP8 Argininosuccinate lyase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=argH PE=3 SV=1 13 454 4.0E-112
sp|P59616|ARLY_CLOTE Argininosuccinate lyase OS=Clostridium tetani (strain Massachusetts / E88) GN=argH PE=3 SV=1 12 442 5.0E-112
sp|C1CAC7|ARLY_STRP7 Argininosuccinate lyase OS=Streptococcus pneumoniae (strain 70585) GN=argH PE=3 SV=1 1 462 9.0E-112
sp|B2T1C7|ARLY_BURPP Argininosuccinate lyase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=argH PE=3 SV=1 13 450 9.0E-112
sp|Q0SI59|ARLY_RHOJR Argininosuccinate lyase OS=Rhodococcus jostii (strain RHA1) GN=argH PE=3 SV=1 9 464 1.0E-111
sp|P50988|ARLY_STRC2 Argininosuccinate lyase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=argH PE=3 SV=2 1 458 1.0E-111
sp|C1CBS9|ARLY_STRZJ Argininosuccinate lyase OS=Streptococcus pneumoniae (strain JJA) GN=argH PE=3 SV=1 1 462 2.0E-111
sp|A8G1Z9|ARLY_PROM2 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9215) GN=argH PE=3 SV=1 12 449 2.0E-111
sp|A3PA59|ARLY_PROM0 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9301) GN=argH PE=3 SV=1 12 459 4.0E-111
sp|Q8XWV7|ARLY_RALSO Argininosuccinate lyase OS=Ralstonia solanacearum (strain GMI1000) GN=argH PE=3 SV=1 13 460 5.0E-111
sp|B7GTN9|ARLY_BIFLS Argininosuccinate lyase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=argH PE=3 SV=1 12 458 8.0E-111
sp|Q8DRI4|ARLY_STRR6 Argininosuccinate lyase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=argH PE=3 SV=1 1 462 9.0E-111
sp|B1I815|ARLY_STRPI Argininosuccinate lyase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=argH PE=3 SV=1 1 462 9.0E-111
sp|Q04MW6|ARLY_STRP2 Argininosuccinate lyase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=argH PE=3 SV=1 1 462 9.0E-111
sp|Q3B0Z0|ARLY_SYNS9 Argininosuccinate lyase OS=Synechococcus sp. (strain CC9902) GN=argH PE=3 SV=2 1 458 9.0E-111
sp|B3QN90|ARLY_CHLP8 Argininosuccinate lyase OS=Chlorobaculum parvum (strain NCIB 8327) GN=argH PE=3 SV=1 1 458 1.0E-110
sp|A2BND8|ARLY_PROMS Argininosuccinate lyase OS=Prochlorococcus marinus (strain AS9601) GN=argH PE=3 SV=1 12 458 2.0E-110
sp|Q6AGC8|ARLY_LEIXX Argininosuccinate lyase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=argH PE=3 SV=1 9 461 2.0E-110
sp|A7H771|ARLY_ANADF Argininosuccinate lyase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=argH PE=3 SV=1 17 458 2.0E-110
sp|B2UA10|ARLY_RALPJ Argininosuccinate lyase OS=Ralstonia pickettii (strain 12J) GN=argH PE=3 SV=1 13 456 3.0E-110
sp|Q8G5F3|ARLY_BIFLO Argininosuccinate lyase OS=Bifidobacterium longum (strain NCC 2705) GN=argH PE=3 SV=1 12 458 3.0E-110
sp|B3DSY6|ARLY_BIFLD Argininosuccinate lyase OS=Bifidobacterium longum (strain DJO10A) GN=argH PE=3 SV=1 12 458 3.0E-110
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2309
MASNSKPGDNMLWGGRFTGGLDPLMVKYNESIYFDRALYSQDIRGSISYARANTKTGILTAQEFEQIEHGLLQIL
KEWETGVFAIIPGVDEDIHTANERRLGEVIGKHVAGKLHTGRSRNEQVVCDMRLWLRDELRAIEQHLVSLMRVVT
ARAETEIDYIMPGYTHLQRAQPIRWSHWLLSYGRAFADDLDRLRQLIKRVNRSPLGCGALAGNPFGIDRDMMASE
LGFDGLLWNSMAGVSDRDFVTETLQWGAMLMQHISRWAEDLIIYSTAEFAFVRLADAYSTGSSLMPQKKNPDSLE
LLRGKSGRAFGHMAGFMMTQKGLPSTYNKDLQESVEPMLDHIKTVSDSIQIANGVLSTLTANPNKMWAALDGFML
ATDIADYLVRKGVPFRETHHISGRCVAKSEETGTPLDKLSYEQFKSIDQRFQEDIVKVFDYEASVERRSARGGTS
KSSVMEQIRVLRDMLD*
Coding >OphauB2|2309
ATGGCGAGCAACTCCAAGCCCGGGGACAACATGCTATGGGGAGGTCGCTTCACAGGCGGCCTCGATCCCCTCATG
GTCAAGTACAACGAGAGCATCTACTTTGATCGGGCGCTGTATTCGCAGGACATTCGCGGCAGCATTTCCTATGCG
CGCGCCAACACCAAGACGGGAATTCTGACAGCCCAAGAGTTCGAGCAGATTGAGCACGGCTTGCTGCAGATCCTC
AAGGAGTGGGAGACGGGTGTCTTTGCCATAATTCCCGGCGTGGACGAAGACATCCACACGGCCAATGAGCGCCGT
CTGGGCGAGGTGATTGGCAAGCATGTGGCTGGGAAGCTGCACACAGGCCGCAGCCGCAATGAGCAGGTCGTCTGT
GACATGCGCCTCTGGCTTCGCGACGAGCTGCGAGCCATTGAGCAGCATCTGGTGTCGTTGATGCGCGTCGTGACT
GCGCGGGCGGAGACGGAAATTGACTACATCATGCCGGGATACACACACCTGCAGCGCGCCCAGCCCATTCGCTGG
AGCCACTGGCTGCTGTCGTACGGGCGGGCCTTTGCTGACGACCTGGACCGTCTGCGCCAGCTCATCAAACGCGTC
AACCGTTCTCCGCTGGGCTGCGGCGCGCTTGCCGGCAATCCTTTTGGCATCGACCGCGACATGATGGCCAGCGAG
CTTGGTTTTGACGGACTGCTCTGGAACTCCATGGCGGGCGTGTCTGACCGCGACTTTGTCACCGAGACGCTTCAG
TGGGGGGCCATGCTCATGCAGCACATCTCGCGCTGGGCCGAGGACCTCATCATCTACTCGACGGCTGAGTTTGCC
TTTGTCCGTCTGGCCGACGCCTACTCAACCGGCAGCTCCCTCATGCCGCAAAAGAAGAACCCCGACAGCCTCGAG
CTGCTTCGCGGCAAAAGCGGCCGTGCCTTTGGCCACATGGCCGGCTTCATGATGACGCAAAAGGGGCTGCCTAGC
ACATACAACAAGGATCTGCAAGAGAGCGTTGAGCCCATGCTTGACCATATAAAGACGGTATCGGACAGCATCCAG
ATTGCAAACGGTGTCTTGTCGACGCTCACTGCCAACCCCAACAAGATGTGGGCCGCGCTCGACGGCTTCATGCTC
GCCACAGACATTGCAGACTACCTGGTTCGCAAGGGCGTGCCCTTTCGCGAGACGCACCACATCTCAGGCCGCTGC
GTCGCAAAGTCGGAGGAGACGGGCACGCCACTTGACAAACTGTCGTATGAGCAGTTCAAGAGCATTGACCAACGC
TTCCAAGAGGACATTGTCAAGGTTTTCGACTACGAGGCCAGTGTCGAGCGGCGGTCGGCCAGGGGCGGCACAAGC
AAGTCGAGTGTCATGGAGCAGATTCGGGTGCTACGGGATATGCTCGACTGA
Transcript >OphauB2|2309
ATGGCGAGCAACTCCAAGCCCGGGGACAACATGCTATGGGGAGGTCGCTTCACAGGCGGCCTCGATCCCCTCATG
GTCAAGTACAACGAGAGCATCTACTTTGATCGGGCGCTGTATTCGCAGGACATTCGCGGCAGCATTTCCTATGCG
CGCGCCAACACCAAGACGGGAATTCTGACAGCCCAAGAGTTCGAGCAGATTGAGCACGGCTTGCTGCAGATCCTC
AAGGAGTGGGAGACGGGTGTCTTTGCCATAATTCCCGGCGTGGACGAAGACATCCACACGGCCAATGAGCGCCGT
CTGGGCGAGGTGATTGGCAAGCATGTGGCTGGGAAGCTGCACACAGGCCGCAGCCGCAATGAGCAGGTCGTCTGT
GACATGCGCCTCTGGCTTCGCGACGAGCTGCGAGCCATTGAGCAGCATCTGGTGTCGTTGATGCGCGTCGTGACT
GCGCGGGCGGAGACGGAAATTGACTACATCATGCCGGGATACACACACCTGCAGCGCGCCCAGCCCATTCGCTGG
AGCCACTGGCTGCTGTCGTACGGGCGGGCCTTTGCTGACGACCTGGACCGTCTGCGCCAGCTCATCAAACGCGTC
AACCGTTCTCCGCTGGGCTGCGGCGCGCTTGCCGGCAATCCTTTTGGCATCGACCGCGACATGATGGCCAGCGAG
CTTGGTTTTGACGGACTGCTCTGGAACTCCATGGCGGGCGTGTCTGACCGCGACTTTGTCACCGAGACGCTTCAG
TGGGGGGCCATGCTCATGCAGCACATCTCGCGCTGGGCCGAGGACCTCATCATCTACTCGACGGCTGAGTTTGCC
TTTGTCCGTCTGGCCGACGCCTACTCAACCGGCAGCTCCCTCATGCCGCAAAAGAAGAACCCCGACAGCCTCGAG
CTGCTTCGCGGCAAAAGCGGCCGTGCCTTTGGCCACATGGCCGGCTTCATGATGACGCAAAAGGGGCTGCCTAGC
ACATACAACAAGGATCTGCAAGAGAGCGTTGAGCCCATGCTTGACCATATAAAGACGGTATCGGACAGCATCCAG
ATTGCAAACGGTGTCTTGTCGACGCTCACTGCCAACCCCAACAAGATGTGGGCCGCGCTCGACGGCTTCATGCTC
GCCACAGACATTGCAGACTACCTGGTTCGCAAGGGCGTGCCCTTTCGCGAGACGCACCACATCTCAGGCCGCTGC
GTCGCAAAGTCGGAGGAGACGGGCACGCCACTTGACAAACTGTCGTATGAGCAGTTCAAGAGCATTGACCAACGC
TTCCAAGAGGACATTGTCAAGGTTTTCGACTACGAGGCCAGTGTCGAGCGGCGGTCGGCCAGGGGCGGCACAAGC
AAGTCGAGTGTCATGGAGCAGATTCGGGTGCTACGGGATATGCTCGACTGA
Gene >OphauB2|2309
ATGGCGAGCAACTCCAAGCCCGGGGACAACATGCTATGGGGAGGTCGCTTCACAGGTAAGAACACGGCCACTACA
TCTTGGGCAAAGGATCCCTCATGGCTCACCCGCGCCGTTTGCAGGCGGCCTCGATCCCCTCATGGTCAAGTACAA
CGAGAGCATCTACTTTGATCGGGCGCTGTATTCGCAGGACATTCGCGGCAGCATTTCCTATGCGCGCGCCAACAC
CAAGACGGGAATTCTGACAGCCCAAGAGTTCGAGCAGATTGAGCACGGCTTGCTGCAGATCCTCAAGGAGTGGGA
GACGGGTGTCTTTGCCATAATTCCCGGCGTGGACGAAGACATCCACACGGCCAATGAGCGCCGTCTGGGCGAGGT
GATTGGCAAGCATGTGGCTGGGAAGCTGCACACAGGCCGCAGCCGCAATGAGCAGGTCGTCTGTGACATGCGCCT
CTGGCTTCGCGACGAGCTGCGAGCCATTGAGCAGCATCTGGTGTCGTTGATGCGCGTCGTGACTGCGCGGGCGGA
GACGGAAATTGACTACATCATGCCGGGATACACACACCTGCAGCGCGCCCAGCCCATTCGCTGGAGCCACTGGCT
GCTGTCGTACGGGCGGGCCTTTGCTGACGACCTGGACCGTCTGCGCCAGCTCATCAAACGCGTCAACCGTTCTCC
GCTGGGCTGCGGCGCGCTTGCCGGCAATCCTTTTGGCATCGACCGCGACATGATGGCCAGCGAGCTTGGTTTTGA
CGGACTGCTCTGGAACTCCATGGCGGGCGTGTCTGACCGCGACTTTGTCACCGAGACGCTTCAGTGGGGGGCCAT
GCTCATGCAGCACATCTCGCGCTGGGCCGAGGACCTCATCATCTACTCGACGGCTGAGTTTGCCTTTGTCCGTCT
GGCCGACGCCTACTCAACCGGCAGCTCCCTCATGCCGCAAAAGAAGAACCCCGACAGCCTCGAGCTGCTTCGCGG
CAAAAGCGGCCGTGCCTTTGGCCACATGGCCGGCTTCATGATGACGCAAAAGGGGCTGCCTAGCACATACAACAA
GGATCTGCAAGAGAGCGTTGAGCCCATGCTTGACCATATAAAGACGGTATCGGACAGCATCCAGATTGCAAACGG
TGTCTTGTCGACGCTCACTGCCAACCCCAACAAGATGTGGGCCGCGCTCGACGGCTTCATGCTCGCCACAGACAT
TGCAGACTACCTGGTTCGCAAGGGCGTGCCCTTTCGCGAGACGCACCACATCTCAGGCCGCTGCGTCGCAAAGTC
GGAGGAGACGGGCACGCCACTTGACAAACTGTCGTATGAGCAGTTCAAGAGCATTGACCAACGCTTCCAAGAGGA
CATTGTCAAGGTTTTCGACTACGAGGCCAGTGTCGAGCGGCGGTCGGCCAGGGGCGGCACAAGCAAGTCGAGTGT
CATGGAGCAGATTCGGGTGCTACGGGATATGCTCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail