Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|23
Gene name
LocationContig_1:59041..60956
Strand-
Gene length (bp)1915
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q18DN4|HMU_HALWD Halomucin OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hmu PE=3 SV=1 101 231 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 67 86 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|23
MLRRAAASAARCSRPTVPRPFALNLLPARKINRSFWWRRKPRNLPIYFPPLPKPPAWRRWGATAGRVSLKVFIFT
FCFFLVEEFVLDPLFNLFEEFDGLLDDLSDRHDSGRGESDDDDGNGTYGNEAEVVYEIFKYSPRREDGEDEINEE
DEDEDEEFDHVEFDGELYHEDADVWNLNRDHYQDGNNDGLGRNNSNKDSSGRNRSNGGDDNDEKNNKKNKDKGDK
ANSDNDKLNILFIPFPFLMVKAVQPRYTEEDDEYAIYNILHYHTEVRHSLQLWLIVAVRNAIHSNHNIMRVLGSP
PIRLLEGELSFGYPARPPAKIYVPGIGFSSDSIFVGYQETNPLTGDLLQSAMYPKAFAQAAWTFLRAFVEQRVHD
VGRSLGIKTGATTNAQHPVGSGTNKAQRASGKVGATPFKSTNYGSPEARDALVYLYQSLGGAFPWVWKKLLRAQA
DDFWREPVNRSLISFAKNWHPRTEKPRRGYVVLRGLLNFTTEKAQIIVKVEGILDFSSNRFTRVTYYTPKIIVYK
KRPKQQQLKSNQGQWSAVQGGQQSKQQSALQAKQRPKQQSNQQSEQQVKQQPQDK*
Coding >OphauB2|23
ATGCTGCGTCGCGCGGCGGCGTCTGCTGCCCGTTGCTCTCGACCAACAGTCCCAAGACCTTTTGCGCTGAATCTC
CTTCCGGCAAGAAAGATCAATCGTTCATTTTGGTGGCGTCGCAAACCTAGAAATCTTCCCATATACTTTCCTCCT
CTTCCAAAGCCTCCCGCTTGGAGGCGATGGGGAGCAACAGCTGGACGCGTCTCGCTCAAAGTCTTTATCTTTACC
TTCTGTTTCTTCCTCGTTGAGGAGTTCGTGCTCGATCCCCTTTTCAACTTGTTTGAAGAGTTTGATGGCTTGCTT
GATGACTTGTCAGATCGGCACGATAGCGGAAGAGGCGAGAGTGACGACGACGACGGCAACGGCACTTATGGTAAT
GAGGCTGAAGTCGTATACGAAATCTTCAAATATTCACCCCGACGTGAAGATGGAGAAGATGAAATCAACGAGGAA
GATGAAGATGAAGATGAAGAATTCGACCATGTAGAATTTGACGGAGAACTCTACCATGAAGATGCAGATGTCTGG
AATTTGAACAGGGATCATTATCAAGATGGAAATAACGATGGACTCGGCCGCAACAATAGCAACAAGGACAGCAGC
GGCAGGAATCGCAGTAACGGGGGCGACGACAATGACGAAAAAAACAACAAGAAAAACAAGGACAAAGGTGACAAG
GCCAACTCGGATAACGATAAGTTGAATATACTATTTATCCCATTCCCTTTCTTGATGGTCAAGGCCGTGCAACCG
CGTTATACCGAAGAGGACGACGAGTACGCGATTTACAATATCCTCCACTACCACACTGAAGTTAGACACAGTCTG
CAACTGTGGTTGATCGTCGCTGTACGAAATGCAATCCACTCCAATCATAACATAATGAGAGTACTTGGAAGCCCG
CCCATTCGCCTTCTTGAGGGTGAGTTGAGCTTTGGGTATCCTGCAAGGCCGCCTGCAAAGATATATGTCCCTGGA
ATTGGGTTTTCATCGGATTCCATTTTCGTGGGCTACCAGGAAACAAATCCACTTACAGGCGATCTGCTACAGTCA
GCCATGTACCCAAAAGCCTTTGCGCAGGCAGCGTGGACCTTTTTGCGAGCCTTTGTTGAGCAGAGGGTACATGAC
GTGGGCAGGTCACTGGGCATCAAGACTGGAGCGACAACGAATGCTCAGCATCCTGTTGGCTCTGGTACGAATAAA
GCACAACGCGCATCTGGAAAAGTTGGTGCTACTCCTTTCAAGTCAACTAACTACGGCAGCCCGGAAGCCAGAGAT
GCTCTTGTATACCTCTATCAGAGTCTGGGGGGTGCTTTTCCATGGGTATGGAAAAAGCTTTTAAGAGCTCAAGCT
GATGATTTCTGGCGGGAACCCGTCAACCGTAGCCTCATCAGCTTTGCCAAGAACTGGCATCCTCGGACTGAAAAG
CCTCGGCGAGGCTATGTGGTTCTCAGAGGCTTACTCAATTTCACCACAGAAAAGGCGCAGATTATTGTGAAAGTG
GAGGGTATTCTTGACTTTTCGTCGAATCGGTTTACCCGCGTCACGTATTATACCCCAAAAATCATTGTTTATAAG
AAGCGACCCAAGCAGCAGCAACTCAAATCAAATCAGGGGCAGTGGTCAGCTGTGCAAGGCGGGCAACAATCGAAG
CAGCAGTCAGCTCTGCAAGCGAAGCAACGGCCGAAGCAGCAGTCGAATCAGCAATCGGAGCAACAGGTGAAGCAA
CAACCACAAGATAAATAA
Transcript >OphauB2|23
ATGCTGCGTCGCGCGGCGGCGTCTGCTGCCCGTTGCTCTCGACCAACAGTCCCAAGACCTTTTGCGCTGAATCTC
CTTCCGGCAAGAAAGATCAATCGTTCATTTTGGTGGCGTCGCAAACCTAGAAATCTTCCCATATACTTTCCTCCT
CTTCCAAAGCCTCCCGCTTGGAGGCGATGGGGAGCAACAGCTGGACGCGTCTCGCTCAAAGTCTTTATCTTTACC
TTCTGTTTCTTCCTCGTTGAGGAGTTCGTGCTCGATCCCCTTTTCAACTTGTTTGAAGAGTTTGATGGCTTGCTT
GATGACTTGTCAGATCGGCACGATAGCGGAAGAGGCGAGAGTGACGACGACGACGGCAACGGCACTTATGGTAAT
GAGGCTGAAGTCGTATACGAAATCTTCAAATATTCACCCCGACGTGAAGATGGAGAAGATGAAATCAACGAGGAA
GATGAAGATGAAGATGAAGAATTCGACCATGTAGAATTTGACGGAGAACTCTACCATGAAGATGCAGATGTCTGG
AATTTGAACAGGGATCATTATCAAGATGGAAATAACGATGGACTCGGCCGCAACAATAGCAACAAGGACAGCAGC
GGCAGGAATCGCAGTAACGGGGGCGACGACAATGACGAAAAAAACAACAAGAAAAACAAGGACAAAGGTGACAAG
GCCAACTCGGATAACGATAAGTTGAATATACTATTTATCCCATTCCCTTTCTTGATGGTCAAGGCCGTGCAACCG
CGTTATACCGAAGAGGACGACGAGTACGCGATTTACAATATCCTCCACTACCACACTGAAGTTAGACACAGTCTG
CAACTGTGGTTGATCGTCGCTGTACGAAATGCAATCCACTCCAATCATAACATAATGAGAGTACTTGGAAGCCCG
CCCATTCGCCTTCTTGAGGGTGAGTTGAGCTTTGGGTATCCTGCAAGGCCGCCTGCAAAGATATATGTCCCTGGA
ATTGGGTTTTCATCGGATTCCATTTTCGTGGGCTACCAGGAAACAAATCCACTTACAGGCGATCTGCTACAGTCA
GCCATGTACCCAAAAGCCTTTGCGCAGGCAGCGTGGACCTTTTTGCGAGCCTTTGTTGAGCAGAGGGTACATGAC
GTGGGCAGGTCACTGGGCATCAAGACTGGAGCGACAACGAATGCTCAGCATCCTGTTGGCTCTGGTACGAATAAA
GCACAACGCGCATCTGGAAAAGTTGGTGCTACTCCTTTCAAGTCAACTAACTACGGCAGCCCGGAAGCCAGAGAT
GCTCTTGTATACCTCTATCAGAGTCTGGGGGGTGCTTTTCCATGGGTATGGAAAAAGCTTTTAAGAGCTCAAGCT
GATGATTTCTGGCGGGAACCCGTCAACCGTAGCCTCATCAGCTTTGCCAAGAACTGGCATCCTCGGACTGAAAAG
CCTCGGCGAGGCTATGTGGTTCTCAGAGGCTTACTCAATTTCACCACAGAAAAGGCGCAGATTATTGTGAAAGTG
GAGGGTATTCTTGACTTTTCGTCGAATCGGTTTACCCGCGTCACGTATTATACCCCAAAAATCATTGTTTATAAG
AAGCGACCCAAGCAGCAGCAACTCAAATCAAATCAGGGGCAGTGGTCAGCTGTGCAAGGCGGGCAACAATCGAAG
CAGCAGTCAGCTCTGCAAGCGAAGCAACGGCCGAAGCAGCAGTCGAATCAGCAATCGGAGCAACAGGTGAAGCAA
CAACCACAAGATAAATAA
Gene >OphauB2|23
ATGCTGCGTCGCGCGGCGGCGTCTGCTGCCCGTTGCTCTCGACCAACAGTCCCAAGACCTTTTGCGCTGAATCTC
CTTCCGGCAAGAAAGATCAATCGTTCATTTTGGTGGCGTCGCAAACCTAGAAATCTTCCCATATACTTTCCTCCT
CTTCCAAAGCCTCCCGCTTGGAGGCGATGGGGAGCAACAGCTGGGTATTTCCTTTTAGCTCGTGCAGTATCCGGG
TTGAATTGGGCTGTAACTGACGTTGACTAGACGCGTCTCGCTCAAAGTCTTTATCTTTACCTTCTGTTTCTTCCT
CGTTGAGGAGTTCGTGCTCGATCCCCTTTTCAACTTGTTTGAAGAGTTTGATGGCTTGCTTGATGACTTGTCAGA
TCGGCACGATAGCGGAAGAGGCGAGAGTGACGACGACGACGGCAACGGCACTTATGGTAATGAGGCTGAAGTCGT
ATACGAAATCTTCAAATATTCACCCCGACGTGAAGATGGAGAAGATGAAATCAACGAGGAAGATGAAGATGAAGA
TGAAGAATTCGACCATGTAGAATTTGACGGAGAACTCTACCATGAAGATGCAGATGTCTGGAATTTGAACAGGGA
TCATTATCAAGATGGAAATAACGATGGACTCGGCCGCAACAATAGCAACAAGGACAGCAGCGGCAGGAATCGCAG
TAACGGGGGCGACGACAATGACGAAAAAAACAACAAGAAAAACAAGGACAAAGGTGACAAGGCCAACTCGGATAA
CGATAAGTTGAATATACTATTTATCCCATTCCCTTTCTTGATGGTCAAGGCCGTGCAACCGCGTTATACCGAAGA
GGACGACGAGTACGCGATTTACAATATCCTCCACTACCACACTGAAGTTAGACACAGTCTGCAACGTGCGTTGGA
ATCAGTGCTCTCATGGCTTGTTACTCGAGGCTGACATTGGTTGCCAGTGTGGTTGATCGTCGCTGTACGAAATGC
AATCCACTCCAATCATAACATAATGAGAGTACTTGGAAGCCCGCCCATTCGCCTTCTTGAGGGTGAGTTGAGCTT
TGGGTATCCTGCAAGGCCGCCTGCAAAGATATATGTCCCTGGGTAAGTCACTTGACAGCTCTCAACCACGTGGGA
ACTCAAGCTCACTATTAATAGAATTGGGTTTTCATCGGATTCCATTTTCGTGGGCTACCAGGAAACAAATCCACT
TACAGGCGATCTGCTACAGTCAGCCATGTACCCAAAAGCCTTTGCGCAGGCAGCGTGGACCTTTTTGCGAGCCTT
TGTTGAGCAGAGGGTACATGACGTGGGCAGGTCACTGGGCATCAAGACTGGAGCGACAACGAATGCTCAGCATCC
TGTTGGCTCTGGTACGAATAAAGCACAACGCGCATCTGGAAAAGTTGGTGCTACTCCTTTCAAGTCAACTAACTA
CGGCAGCCCGGAAGCCAGAGATGCTCTTGTATACCTCTATCAGAGTCTGGGGGGTGCTTTTCCATGGGTATGGAA
AAAGCTTTTAAGAGCTCAAGCTGATGATTTCTGGCGGGAACCCGTCAACCGTAGCCTCATCAGCTTTGCCAAGAA
CTGGCATCCTCGGACTGAAAAGCCTCGGCGAGGCTATGTGGTTCTCAGAGGCTTACTCAATTTCACCACAGAAAA
GGCGCAGATTATTGTGAAAGTGGAGGGTATTCTTGACTTTTCGTCGAATCGGTTTACCCGCGTCACGTATTATAC
CCCAAAAATCATTGTTTATAAGAAGCGACCCAAGCAGCAGCAACTCAAATCAAATCAGGGGCAGTGGTCAGCTGT
GCAAGGCGGGCAACAATCGAAGCAGCAGTCAGCTCTGCAAGCGAAGCAACGGCCGAAGCAGCAGTCGAATCAGCA
ATCGGAGCAACAGGTGAAGCAACAACCACAAGATAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail