Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2285
Gene name
LocationContig_17:144895..147092
Strand+
Gene length (bp)2197
Transcript length (bp)2079
Coding sequence length (bp)2079
Protein length (aa) 693

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47 4.5E-168 165 654

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J0Q0|MNS1_CANAX Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans GN=MNS1 PE=3 SV=2 151 673 6.0E-176
sp|Q93Y37|MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana GN=MNS3 PE=2 SV=1 155 653 2.0E-137
sp|P32906|MNS1_YEAST Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNS1 PE=1 SV=1 157 665 9.0E-137
sp|Q9P7C3|MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P5.01c PE=1 SV=2 158 656 2.0E-131
sp|Q9UKM7|MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens GN=MAN1B1 PE=1 SV=2 133 653 7.0E-124
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J0Q0|MNS1_CANAX Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans GN=MNS1 PE=3 SV=2 151 673 6.0E-176
sp|Q93Y37|MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana GN=MNS3 PE=2 SV=1 155 653 2.0E-137
sp|P32906|MNS1_YEAST Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNS1 PE=1 SV=1 157 665 9.0E-137
sp|Q9P7C3|MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P5.01c PE=1 SV=2 158 656 2.0E-131
sp|Q9UKM7|MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens GN=MAN1B1 PE=1 SV=2 133 653 7.0E-124
sp|B2GUY0|MA1B1_RAT Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus GN=Man1b1 PE=2 SV=2 157 653 2.0E-114
sp|A2AJ15|MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus GN=Man1b1 PE=1 SV=1 157 653 8.0E-114
sp|Q9C512|MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana GN=MNS1 PE=1 SV=1 156 652 6.0E-101
sp|Q8H116|MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana GN=MNS2 PE=1 SV=1 157 652 8.0E-97
sp|O60476|MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens GN=MAN1A2 PE=1 SV=1 154 664 3.0E-83
sp|P45701|MA1A1_RABIT Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Fragment) OS=Oryctolagus cuniculus GN=MAN1A1 PE=1 SV=1 157 653 3.0E-83
sp|P45700|MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus GN=Man1a1 PE=1 SV=1 157 653 3.0E-82
sp|P39098|MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus GN=Man1a2 PE=1 SV=1 153 657 9.0E-82
sp|O02773|MA1A1_PIG Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Sus scrofa GN=MAN1A1 PE=1 SV=1 151 653 2.0E-79
sp|P33908|MA1A1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens GN=MAN1A1 PE=1 SV=3 157 653 3.0E-79
sp|Q18788|MAN12_CAEEL Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 OS=Caenorhabditis elegans GN=C52E4.5 PE=1 SV=1 158 653 5.0E-78
sp|P53624|MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster GN=alpha-Man-Ia PE=1 SV=2 156 653 2.0E-75
sp|Q9NR34|MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens GN=MAN1C1 PE=1 SV=1 158 653 3.0E-74
sp|Q2ULB2|MNS1B_ASPOR Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mns1B PE=1 SV=1 156 652 6.0E-57
sp|B8N417|MNS1B_ASPFN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mns1B PE=3 SV=2 156 652 6.0E-57
sp|Q0D076|MNS1B_ASPTN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mns1B PE=3 SV=1 156 650 1.0E-52
sp|Q12563|MNS1B_ASPPH Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis GN=mns1B PE=2 SV=1 156 650 1.0E-52
sp|A2QAS2|MNS1B_ASPNC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mns1B PE=3 SV=1 156 650 4.0E-52
sp|A1CP08|MNS1B_ASPCL Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mns1B PE=3 SV=1 158 652 4.0E-46
sp|Q5BF93|MNS1B_EMENI Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mns1B PE=2 SV=2 156 650 5.0E-46
sp|P31723|MAN12_PENCI Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum GN=MSDC PE=1 SV=2 119 652 1.0E-45
sp|Q4WRZ5|MNS1B_ASPFU Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mns1B PE=3 SV=1 154 634 2.0E-44
sp|B0XMT4|MNS1B_ASPFC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mns1B PE=3 SV=1 154 634 2.0E-44
sp|D4AV26|MNS1B_ARTBC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00035 PE=1 SV=1 156 652 2.0E-44
sp|A1D1W1|MNS1B_NEOFI Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mns1B PE=3 SV=1 154 634 4.0E-44
sp|E9CXX8|MNS1B_COCPS Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_02648 PE=1 SV=1 156 658 6.0E-44
sp|O94726|MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnl1 PE=3 SV=2 157 653 9.0E-38
sp|Q6GQB9|EDEM3_XENLA ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis GN=edem3 PE=2 SV=2 149 653 7.0E-36
sp|Q92611|EDEM1_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens GN=EDEM1 PE=1 SV=1 166 652 2.0E-35
sp|Q925U4|EDEM1_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus GN=Edem1 PE=1 SV=1 166 652 4.0E-35
sp|Q9FG93|MNS4_ARATH Probable alpha-mannosidase I MNS4 OS=Arabidopsis thaliana GN=MNS4 PE=2 SV=1 114 419 2.0E-34
sp|Q9BZQ6|EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens GN=EDEM3 PE=1 SV=2 138 653 9.0E-30
sp|Q9BV94|EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens GN=EDEM2 PE=1 SV=2 121 394 5.0E-29
sp|Q9SXC9|MNS5_ARATH Probable alpha-mannosidase I MNS5 OS=Arabidopsis thaliana GN=MNS5 PE=2 SV=1 146 411 1.0E-28
sp|Q2HXL6|EDEM3_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus GN=Edem3 PE=1 SV=2 148 397 6.0E-20
sp|P38888|MNL1_YEAST ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNL1 PE=1 SV=1 159 421 7.0E-15
sp|Q2HXL6|EDEM3_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus GN=Edem3 PE=1 SV=2 557 653 6.0E-09
sp|Q9SXC9|MNS5_ARATH Probable alpha-mannosidase I MNS5 OS=Arabidopsis thaliana GN=MNS5 PE=2 SV=1 557 652 9.0E-08
sp|Q9BV94|EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens GN=EDEM2 PE=1 SV=2 557 652 1.0E-07
sp|Q9FG93|MNS4_ARATH Probable alpha-mannosidase I MNS4 OS=Arabidopsis thaliana GN=MNS4 PE=2 SV=1 557 653 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0004571 mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Yes
GO:0005509 calcium ion binding Yes
GO:0016787 hydrolase activity No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0004559 alpha-mannosidase activity No
GO:0015923 mannosidase activity No
GO:0005575 cellular_component No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0015924 mannosyl-oligosaccharide mannosidase activity No
GO:0003674 molecular_function No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0110165 cellular anatomical entity No
GO:0046872 metal ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 110 132 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH47 5.8E-164 165 654

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2793
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1686
Ophiocordyceps australis map64 (Brazil) OphauB2|2285 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07192
Ophiocordyceps camponoti-rufipedis Ophun1|2339
Ophiocordyceps kimflemingae Ophio5|551
Ophiocordyceps subramaniannii Hirsu2|4475

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2285
MIRDPFDIHRKNLLQQPTLFGIAPHTEDTELRDSDMSFAVPRNLPNFGAPHRDLEDRAWATTSRHSNGGGILNQV
QDRVTGLFDSNELPMYKDKPYPSTRRRSWWKRKRILSTVVLGLLSILYLLGLLSGHGNKHKSAKTWPWSGPASGK
GAVDWEERRQHVVEAFELSWDAYERYAWGYDEFHPISKTGKHMAPKGLGWIIIDSLDTLMLMNQTKRLQHARQWL
SKSLTWDQDQDVNTFETTIRMLGGLLSAHYLSSEYPDLAPLSEDDVEDLYLEKAKDVADRLLSAFESPSGIPYAS
VNLEKFVGIPSHADMGASSTAEATSLQLEFKYLAKLTGEKHFWDKVEKVMQVVDDNKAQDGLVPIYIYATNGEFR
GSNVRLGSRGDSYYEYLIKQYLQTNKQEPIYEEMWRESLEGVRKHLITYTEHSGLTIIGERPEGLDGYLSPKMDH
LVCFMPGTIALAATEGLSEAEARKLATWSSKKEEDMKLAHELMQTCWAMYKYMATGLAAEITHFHIGDVAQKESA
KHEAPRELDPDPEAAWRRDLMVKGNDVHNLQRPETVESLFYMWRITGDVRYREWGWDMFVSFVNYTAVEDRGGFS
SLSDASVVPPVMRDNMESFWLAETLKYFFLLFSPDHVLPLDKVVLNTEAHALPRFEMGPMLSTGWKRKPRHDEAQ
TAAAASLTRGVQGETAN*
Coding >OphauB2|2285
ATGATTCGCGATCCGTTCGATATCCACCGCAAAAACCTGCTCCAGCAGCCAACTCTCTTTGGCATTGCACCACAC
ACAGAGGACACGGAATTGCGGGATTCTGACATGTCCTTTGCTGTACCGCGGAACTTGCCCAATTTTGGCGCGCCG
CACCGTGACTTGGAAGACCGAGCATGGGCTACCACTTCTAGGCACAGTAACGGAGGAGGCATCTTGAACCAGGTC
CAGGATCGCGTAACGGGCTTGTTTGACTCTAATGAGCTGCCCATGTACAAAGACAAGCCCTATCCATCGACTCGG
AGGCGGTCGTGGTGGAAGCGCAAACGCATCTTGAGCACCGTTGTACTCGGCTTGCTATCTATTCTTTACTTGCTG
GGTCTCTTGTCCGGCCACGGCAACAAGCACAAATCAGCCAAGACGTGGCCATGGTCAGGGCCAGCGTCTGGCAAG
GGTGCTGTCGACTGGGAAGAACGGCGGCAGCACGTGGTGGAAGCGTTTGAGCTGAGCTGGGACGCCTACGAGCGT
TACGCGTGGGGCTATGACGAATTTCATCCGATATCGAAAACGGGAAAGCATATGGCTCCCAAGGGTCTGGGATGG
ATCATCATTGACTCGCTCGACACGCTGATGCTCATGAACCAGACGAAACGGCTCCAGCACGCGCGCCAATGGCTC
TCCAAATCATTGACGTGGGATCAAGATCAAGACGTCAATACTTTTGAGACGACGATACGCATGCTGGGAGGTCTC
CTCTCAGCACACTATCTATCTAGCGAATATCCCGACTTGGCGCCTCTCAGCGAGGACGACGTCGAGGACCTGTAC
TTGGAAAAGGCCAAGGATGTTGCGGACCGGCTGCTCTCTGCTTTTGAGTCTCCGTCTGGAATTCCCTACGCTAGC
GTCAACCTGGAAAAGTTTGTAGGAATACCGTCTCACGCCGACATGGGAGCATCCTCGACAGCAGAAGCGACAAGC
TTGCAGCTCGAGTTCAAGTACCTTGCCAAGCTGACGGGCGAGAAACATTTCTGGGACAAGGTGGAAAAAGTGATG
CAAGTTGTTGACGACAACAAGGCGCAGGATGGGCTGGTGCCAATTTACATATACGCCACCAACGGCGAGTTTCGG
GGAAGCAACGTGCGGCTGGGCAGCCGAGGAGACTCGTACTACGAGTACCTGATCAAGCAGTATCTACAGACCAAC
AAGCAGGAGCCTATATACGAGGAGATGTGGAGGGAATCGCTGGAGGGGGTGCGCAAGCACCTGATTACCTACACG
GAGCACTCGGGCCTCACCATTATTGGCGAGCGCCCCGAAGGCCTAGACGGGTATCTGTCGCCAAAAATGGACCAT
TTGGTGTGTTTTATGCCTGGCACTATTGCGCTAGCTGCCACAGAAGGGCTCAGCGAGGCAGAGGCGCGCAAGCTG
GCGACGTGGAGTAGCAAGAAGGAAGAGGACATGAAGCTGGCACACGAGCTGATGCAGACATGCTGGGCCATGTAC
AAGTACATGGCGACGGGGCTGGCGGCGGAAATCACGCACTTTCACATTGGCGATGTGGCGCAGAAAGAGTCTGCC
AAGCACGAGGCACCAAGGGAGCTGGACCCGGATCCAGAGGCTGCGTGGCGGCGCGACTTGATGGTCAAGGGCAAC
GACGTGCACAACCTGCAGCGGCCGGAAACGGTCGAGAGCTTGTTTTACATGTGGAGGATCACGGGCGACGTGCGA
TATCGCGAGTGGGGCTGGGACATGTTTGTATCCTTTGTCAACTATACGGCAGTGGAGGACCGGGGCGGCTTCTCG
AGCCTGAGCGACGCCAGCGTGGTGCCTCCTGTCATGAGGGACAATATGGAGAGCTTCTGGCTGGCCGAGACGCTC
AAGTATTTTTTCCTGCTCTTCTCGCCAGACCATGTCTTGCCGCTGGACAAGGTGGTGCTCAACACAGAGGCACAT
GCACTGCCGCGCTTTGAAATGGGGCCAATGCTGTCGACGGGATGGAAACGCAAGCCTCGACATGACGAGGCCCAG
ACGGCGGCAGCGGCGTCGTTGACGCGAGGAGTGCAGGGCGAAACGGCAAACTAG
Transcript >OphauB2|2285
ATGATTCGCGATCCGTTCGATATCCACCGCAAAAACCTGCTCCAGCAGCCAACTCTCTTTGGCATTGCACCACAC
ACAGAGGACACGGAATTGCGGGATTCTGACATGTCCTTTGCTGTACCGCGGAACTTGCCCAATTTTGGCGCGCCG
CACCGTGACTTGGAAGACCGAGCATGGGCTACCACTTCTAGGCACAGTAACGGAGGAGGCATCTTGAACCAGGTC
CAGGATCGCGTAACGGGCTTGTTTGACTCTAATGAGCTGCCCATGTACAAAGACAAGCCCTATCCATCGACTCGG
AGGCGGTCGTGGTGGAAGCGCAAACGCATCTTGAGCACCGTTGTACTCGGCTTGCTATCTATTCTTTACTTGCTG
GGTCTCTTGTCCGGCCACGGCAACAAGCACAAATCAGCCAAGACGTGGCCATGGTCAGGGCCAGCGTCTGGCAAG
GGTGCTGTCGACTGGGAAGAACGGCGGCAGCACGTGGTGGAAGCGTTTGAGCTGAGCTGGGACGCCTACGAGCGT
TACGCGTGGGGCTATGACGAATTTCATCCGATATCGAAAACGGGAAAGCATATGGCTCCCAAGGGTCTGGGATGG
ATCATCATTGACTCGCTCGACACGCTGATGCTCATGAACCAGACGAAACGGCTCCAGCACGCGCGCCAATGGCTC
TCCAAATCATTGACGTGGGATCAAGATCAAGACGTCAATACTTTTGAGACGACGATACGCATGCTGGGAGGTCTC
CTCTCAGCACACTATCTATCTAGCGAATATCCCGACTTGGCGCCTCTCAGCGAGGACGACGTCGAGGACCTGTAC
TTGGAAAAGGCCAAGGATGTTGCGGACCGGCTGCTCTCTGCTTTTGAGTCTCCGTCTGGAATTCCCTACGCTAGC
GTCAACCTGGAAAAGTTTGTAGGAATACCGTCTCACGCCGACATGGGAGCATCCTCGACAGCAGAAGCGACAAGC
TTGCAGCTCGAGTTCAAGTACCTTGCCAAGCTGACGGGCGAGAAACATTTCTGGGACAAGGTGGAAAAAGTGATG
CAAGTTGTTGACGACAACAAGGCGCAGGATGGGCTGGTGCCAATTTACATATACGCCACCAACGGCGAGTTTCGG
GGAAGCAACGTGCGGCTGGGCAGCCGAGGAGACTCGTACTACGAGTACCTGATCAAGCAGTATCTACAGACCAAC
AAGCAGGAGCCTATATACGAGGAGATGTGGAGGGAATCGCTGGAGGGGGTGCGCAAGCACCTGATTACCTACACG
GAGCACTCGGGCCTCACCATTATTGGCGAGCGCCCCGAAGGCCTAGACGGGTATCTGTCGCCAAAAATGGACCAT
TTGGTGTGTTTTATGCCTGGCACTATTGCGCTAGCTGCCACAGAAGGGCTCAGCGAGGCAGAGGCGCGCAAGCTG
GCGACGTGGAGTAGCAAGAAGGAAGAGGACATGAAGCTGGCACACGAGCTGATGCAGACATGCTGGGCCATGTAC
AAGTACATGGCGACGGGGCTGGCGGCGGAAATCACGCACTTTCACATTGGCGATGTGGCGCAGAAAGAGTCTGCC
AAGCACGAGGCACCAAGGGAGCTGGACCCGGATCCAGAGGCTGCGTGGCGGCGCGACTTGATGGTCAAGGGCAAC
GACGTGCACAACCTGCAGCGGCCGGAAACGGTCGAGAGCTTGTTTTACATGTGGAGGATCACGGGCGACGTGCGA
TATCGCGAGTGGGGCTGGGACATGTTTGTATCCTTTGTCAACTATACGGCAGTGGAGGACCGGGGCGGCTTCTCG
AGCCTGAGCGACGCCAGCGTGGTGCCTCCTGTCATGAGGGACAATATGGAGAGCTTCTGGCTGGCCGAGACGCTC
AAGTATTTTTTCCTGCTCTTCTCGCCAGACCATGTCTTGCCGCTGGACAAGGTGGTGCTCAACACAGAGGCACAT
GCACTGCCGCGCTTTGAAATGGGGCCAATGCTGTCGACGGGATGGAAACGCAAGCCTCGACATGACGAGGCCCAG
ACGGCGGCAGCGGCGTCGTTGACGCGAGGAGTGCAGGGCGAAACGGCAAACTAG
Gene >OphauB2|2285
ATGATTCGCGATCCGTTCGATATCCACCGCAAAAACCTGCTCCAGCAGCCAACTCTCTTTGGCATTGCACCACAC
ACAGAGGACACGGAATTGCGGGATTCTGACATGTCCTTTGCTGTACCGCGGAACTTGCCCAATTTTGGCGCGCCG
CACCGTGACTTGGAAGACCGAGCATGGGCTACCACTTCTAGGCACAGTAACGGAGGAGGCATCTTGAACCAGGTC
CAGGATCGCGTAACGGGCTTGTTTGACTCTAATGAGCTGCCCATGTACAAAGACAAGCCCTATCCATCGACTCGG
AGGCGGTCGTGGTGGAAGCGCAAACGCATCTTGAGCACCGTTGTACTCGGCTTGCTATCTATTCTTTACTTGCTG
GGTCTCTTGTCCGGCCACGGCAACAAGCACAAATCAGCCAAGACGTGGCCATGGTCAGGGCCAGCGTCTGGCAAG
GGTGCTGTCGACTGGGAAGAACGGCGGCAGCACGTGGTGGAAGCGTTTGAGCTGAGCTGGGACGCCTACGAGCGT
TACGCGTGGGGTGTGTCATAGTTCACCTCGGTGACCCTTGGCAGCCATCTTCTCTGACAAACAAGGCATCTGCAG
GCTATGACGAATTTCATCCGATATCGAAAACGGGAAAGCATATGGCTCCCAAGGGTCTGGGATGGATCATCATTG
ACTCGCTCGACACGCTGATGCTCATGAACCAGACGAAACGGCTCCAGCACGCGCGCCAATGGCTCTCCAAATCAT
TGACGTGGGATCAAGATCAAGACGTCAATACTTTTGAGACGACGATACGCATGCTGGGAGGTCTCCTCTCAGCAC
ACTATCTATCTAGCGAATATCCCGACTTGGCGCCTCTCAGCGAGGACGACGTCGAGGACCTGTACTTGGAAAAGG
CCAAGGATGTTGCGGACCGGCTGCTCTCTGCTTTTGAGTCTCCGTCTGGAATTCCCTACGCTAGCGTCAACCTGG
AAAAGTTTGTAGGAATACCGTCTCACGCCGACATGGGAGCATCCTCGACAGCAGAAGCGACAAGCTTGCAGCTCG
AGTTCAAGTACCTTGCCAAGCTGACGGGCGAGAAACATTTCTGGGACAAGGTGGAAAAAGTGATGCAAGTTGTTG
ACGACAACAAGGCGCAGGATGGGCTGGTGCCAATTTACATATACGCCACCAACGGCGAGTTTCGGGGAAGCAACG
TGCGGCTGGGCAGCCGAGGAGACTCGTACTACGAGTACCTGATCAAGCAGTATCTACAGACCAACAAGCAGGAGC
CTATATACGAGGAGATGTGGAGGGAATCGCTGGAGGGGGTGCGCAAGCACCTGATTACCTACACGGAGCACTCGG
GCCTCACCATTATTGGCGAGCGCCCCGAAGGCCTAGACGGGTATCTGTCGCCAAAAATGGACCATTTGGTGTGTT
TTATGCCTGGCACTATTGCGCTAGCTGCCACAGAAGGGCTCAGCGAGGCAGAGGCGCGCAAGCTGGCGACGTGGA
GTAGCAAGAAGGAAGAGGACATGAAGCTGGCACACGAGCTGATGCAGACATGCTGGGCCATGTACAAGTACATGG
CGACGGGGCTGGCGGCGGAAATCACGCACTTTCACATTGGCGATGTGGCGCAGAAAGAGTCTGCCAAGCACGAGG
CACCAAGGGAGCTGGACCCGGATCCAGAGGCTGCGTGGCGGCGCGACTTGATGGTCAAGGGCAACGACGTGCACA
ACCTGCAGCGGCCGGAAACGGTCGAGAGCTTGTTTTACATGTGGAGGATCACGGGCGACGTGCGATATCGCGAGT
GGGGCTGGGACATGTTTGTATCCTTTGTCAACTATACGGCAGTGGAGGACCGGGGCGGCTTCTCGAGCCTGAGCG
ACGCCAGCGTGGTGCCTCCTGTCATGAGGGACAATATGGAGAGCTTCTGGCTGGTCAGTGGTGTTTTGACACGAT
GTTTGCCTCGAGCGCCGCTGACGGAACACAGGCCGAGACGCTCAAGTATTTTTTCCTGCTCTTCTCGCCAGACCA
TGTCTTGCCGCTGGACAAGGTGGTGCTCAACACAGAGGCACATGCACTGCCGCGCTTTGAAATGGGGCCAATGCT
GTCGACGGGATGGAAACGCAAGCCTCGACATGACGAGGCCCAGACGGCGGCAGCGGCGTCGTTGACGCGAGGAGT
GCAGGGCGAAACGGCAAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail