Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2281
Gene name
LocationContig_17:140328..140910
Strand+
Gene length (bp)582
Transcript length (bp)378
Coding sequence length (bp)378
Protein length (aa) 126

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP 3.4E-40 9 124

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37552|RIDA_BACSU 2-iminobutanoate/2-iminopropanoate deaminase OS=Bacillus subtilis (strain 168) GN=yabJ PE=1 SV=3 7 124 7.0E-40
sp|O58584|Y854_PYRHO RutC family protein PH0854 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0854 PE=1 SV=2 4 123 1.0E-36
sp|Q9UZA3|Y1251_PYRAB RutC family protein PYRAB12510 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB12510 PE=3 SV=1 4 123 5.0E-36
sp|Q8U308|RIDA_PYRFU 2-iminobutanoate/2-iminopropanoate deaminase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=yjgF PE=1 SV=1 4 123 3.0E-35
sp|O43003|MMF1_SCHPO Protein mmf1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mmf1 PE=3 SV=1 17 124 8.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37552|RIDA_BACSU 2-iminobutanoate/2-iminopropanoate deaminase OS=Bacillus subtilis (strain 168) GN=yabJ PE=1 SV=3 7 124 7.0E-40
sp|O58584|Y854_PYRHO RutC family protein PH0854 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0854 PE=1 SV=2 4 123 1.0E-36
sp|Q9UZA3|Y1251_PYRAB RutC family protein PYRAB12510 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB12510 PE=3 SV=1 4 123 5.0E-36
sp|Q8U308|RIDA_PYRFU 2-iminobutanoate/2-iminopropanoate deaminase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=yjgF PE=1 SV=1 4 123 3.0E-35
sp|O43003|MMF1_SCHPO Protein mmf1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mmf1 PE=3 SV=1 17 124 8.0E-35
sp|P40185|MMF1_YEAST Protein MMF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMF1 PE=1 SV=1 5 124 2.0E-34
sp|P40037|HMF1_YEAST Protein HMF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMF1 PE=1 SV=1 29 123 4.0E-33
sp|P55654|Y4SK_RHISN RutC family protein y4sK OS=Rhizobium sp. (strain NGR234) GN=NGR_a01620 PE=3 SV=1 7 122 3.0E-28
sp|Q973T6|Y811_SULTO RutC family protein STK_08110 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_08110 PE=1 SV=1 7 122 1.0E-27
sp|P57452|Y371_BUCAI RutC family protein BU371 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=BU371 PE=3 SV=1 6 124 9.0E-27
sp|O34133|ALDR_LACLA Putative regulator AldR OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=aldR PE=3 SV=2 6 123 1.0E-26
sp|Q97U19|Y3206_SULSO RutC family protein SSO3206 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO3206 PE=3 SV=1 6 123 2.0E-26
sp|P52760|UK114_MOUSE Ribonuclease UK114 OS=Mus musculus GN=Hrsp12 PE=1 SV=3 4 124 2.0E-26
sp|P52758|UK114_HUMAN Ribonuclease UK114 OS=Homo sapiens GN=HRSP12 PE=1 SV=1 4 124 4.0E-26
sp|Q9L6B5|Y1466_PASMU RutC family protein PM1466 OS=Pasteurella multocida (strain Pm70) GN=PM1466 PE=3 SV=1 6 124 4.0E-26
sp|O66689|Y364_AQUAE RutC family protein aq_364 OS=Aquifex aeolicus (strain VF5) GN=aq_364 PE=3 SV=1 9 124 4.0E-26
sp|Q8K9H7|Y359_BUCAP RutC family protein BUsg_359 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_359 PE=3 SV=1 6 124 7.0E-26
sp|P0AF95|RIDA_SHIFL 2-iminobutanoate/2-iminopropanoate deaminase OS=Shigella flexneri GN=yjgF PE=3 SV=2 7 124 1.0E-25
sp|P0AF93|RIDA_ECOLI 2-iminobutanoate/2-iminopropanoate deaminase OS=Escherichia coli (strain K12) GN=ridA PE=1 SV=2 7 124 1.0E-25
sp|P0AF94|RIDA_ECOL6 2-iminobutanoate/2-iminopropanoate deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yjgF PE=3 SV=2 7 124 1.0E-25
sp|O52178|DFRA_MYXXA Protein DfrA OS=Myxococcus xanthus GN=dfrA PE=3 SV=1 7 124 3.0E-25
sp|P52761|Y709_SYNY3 RutC family protein slr0709 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0709 PE=3 SV=1 6 124 3.0E-25
sp|Q3T114|UK114_BOVIN Ribonuclease UK114 OS=Bos taurus GN=HRSP12 PE=2 SV=3 4 124 4.0E-25
sp|Q7CP78|RIDA_SALTY 2-iminobutanoate/2-iminopropanoate deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ridA PE=1 SV=1 7 124 4.0E-25
sp|P52759|UK114_RAT Ribonuclease UK114 OS=Rattus norvegicus GN=Hrsp12 PE=1 SV=3 4 124 5.0E-25
sp|P80601|UK114_CAPHI Ribonuclease UK114 OS=Capra hircus GN=HRSP12 PE=1 SV=3 4 124 1.0E-24
sp|P44839|Y719_HAEIN RutC family protein HI_0719 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0719 PE=1 SV=1 6 124 1.0E-24
sp|P0AGL4|TDCF_SHIFL Putative reactive intermediate deaminase TdcF OS=Shigella flexneri GN=tdcF PE=3 SV=1 6 124 2.0E-24
sp|P0AGL2|TDCF_ECOLI Putative reactive intermediate deaminase TdcF OS=Escherichia coli (strain K12) GN=tdcF PE=1 SV=1 6 124 2.0E-24
sp|P0AGL3|TDCF_ECOL6 Putative reactive intermediate deaminase TdcF OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tdcF PE=3 SV=1 6 124 2.0E-24
sp|P40431|YVN1_AZOVI RutC family protein in vnfA 5'region OS=Azotobacter vinelandii PE=3 SV=2 4 122 3.0E-24
sp|O25598|Y944_HELPY RutC family protein HP_0944 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0944 PE=3 SV=1 6 124 4.0E-24
sp|Q10121|YSD2_CAEEL RutC family protein C23G10.2 OS=Caenorhabditis elegans GN=C23G10.2 PE=3 SV=3 4 124 6.0E-24
sp|Q9ZKQ6|Y944_HELPJ RutC family protein jhp_0879 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0879 PE=3 SV=1 6 124 7.0E-24
sp|Q94JQ4|RIDA_ARATH Reactive Intermediate Deaminase A, chloroplastic OS=Arabidopsis thaliana GN=RIDA PE=1 SV=1 6 123 1.0E-23
sp|Q9UR06|MMF2_SCHPO Protein mmf2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mmf2 PE=3 SV=1 17 123 2.0E-22
sp|P97117|Y142_LEUMC RutC family protein in leuC 5'region OS=Leuconostoc mesenteroides subsp. cremoris PE=3 SV=1 6 124 1.0E-21
sp|Q89AG0|Y334_BUCBP RutC family protein bbp_334 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bbp_334 PE=3 SV=1 7 123 1.0E-21
sp|Q6FFZ5|RUTC_ACIAD Putative aminoacrylate peracid reductase RutC OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rutC PE=3 SV=1 4 123 3.0E-15
sp|A8IAD2|RUTC_AZOC5 Putative aminoacrylate peracid reductase RutC OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutC PE=3 SV=1 15 123 2.0E-14
sp|A1JMX4|RUTC_YERE8 Putative aminoacrylate peracid reductase RutC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rutC PE=3 SV=1 1 123 5.0E-14
sp|B1M5I6|RUTC_METRJ Putative aminoacrylate peracid reductase RutC OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rutC PE=3 SV=1 4 123 5.0E-14
sp|B1ZB17|RUTC_METPB Putative aminoacrylate peracid reductase RutC OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rutC PE=3 SV=1 4 123 8.0E-13
sp|A9W3H9|RUTC_METEP Putative aminoacrylate peracid reductase RutC OS=Methylobacterium extorquens (strain PA1) GN=rutC PE=3 SV=1 4 123 1.0E-12
sp|C7CM34|RUTC_METED Putative aminoacrylate peracid reductase RutC OS=Methylobacterium extorquens (strain DSM 5838 / DM4) GN=rutC PE=3 SV=1 4 123 1.0E-12
sp|B7KWT5|RUTC_METC4 Putative aminoacrylate peracid reductase RutC OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rutC PE=3 SV=1 4 123 1.0E-12
sp|D5VGV2|RUTC_CAUST Putative aminoacrylate peracid reductase RutC OS=Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059) GN=rutC PE=3 SV=1 4 123 2.0E-12
sp|C5B0U7|RUTC_METEA Putative aminoacrylate peracid reductase RutC OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=rutC PE=3 SV=1 4 123 3.0E-12
sp|Q9A4N4|RUTC_CAUCR Putative aminoacrylate peracid reductase RutC OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rutC PE=3 SV=1 4 123 6.0E-12
sp|B8H1Q2|RUTC_CAUCN Putative aminoacrylate peracid reductase RutC OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rutC PE=3 SV=1 4 123 6.0E-12
sp|B9JLT7|RUTC_AGRRK Putative aminoacrylate peracid reductase RutC OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rutC PE=3 SV=1 4 123 1.0E-10
sp|A4VQH6|RUTC_PSEU5 Putative aminoacrylate peracid reductase RutC OS=Pseudomonas stutzeri (strain A1501) GN=rutC PE=3 SV=1 15 123 1.0E-10
sp|D3RKL2|RUTC_KLEVT Putative aminoacrylate peracid reductase RutC OS=Klebsiella variicola (strain At-22) GN=rutC PE=3 SV=1 14 123 2.0E-10
sp|B5XXN2|RUTC_KLEP3 Putative aminoacrylate peracid reductase RutC OS=Klebsiella pneumoniae (strain 342) GN=rutC PE=3 SV=1 14 123 2.0E-10
sp|Q7CWX2|RUTC_AGRFC Putative aminoacrylate peracid reductase RutC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rutC PE=3 SV=2 15 123 2.0E-10
sp|D4GEU6|RUTC_PANAM Putative aminoacrylate peracid reductase RutC OS=Pantoea ananatis (strain LMG 20103) GN=rutC PE=3 SV=1 14 123 2.0E-10
sp|B0SW61|RUTC_CAUSK Putative aminoacrylate peracid reductase RutC OS=Caulobacter sp. (strain K31) GN=rutC PE=3 SV=1 4 123 3.0E-10
sp|D0LI57|RUTC_HALO1 Putative aminoacrylate peracid reductase RutC OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=rutC PE=3 SV=1 13 123 3.0E-10
sp|A6T7A0|RUTC_KLEP7 Putative aminoacrylate peracid reductase RutC OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rutC PE=3 SV=1 15 123 7.0E-10
sp|A8GCT4|RUTC_SERP5 Putative aminoacrylate peracid reductase RutC OS=Serratia proteamaculans (strain 568) GN=rutC PE=3 SV=1 4 123 1.0E-09
sp|A7ME54|RUTC_CROS8 Putative aminoacrylate peracid reductase RutC OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rutC PE=3 SV=1 4 123 3.0E-09
sp|C9Y0S5|RUTC_SICTZ Putative aminoacrylate peracid reductase RutC OS=Siccibacter turicensis (strain DSM 18703 / LMG 23827 / z3032) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|C5CN81|RUTC_VARPS Putative aminoacrylate peracid reductase RutC OS=Variovorax paradoxus (strain S110) GN=rutC PE=3 SV=1 14 123 8.0E-09
sp|D5CE34|RUTC_ENTCC Putative aminoacrylate peracid reductase RutC OS=Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56) GN=rutC PE=3 SV=1 4 123 8.0E-09
sp|Q48MQ6|RUTC_PSE14 Putative aminoacrylate peracid reductase RutC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rutC PE=3 SV=1 15 123 8.0E-08
sp|A4W923|RUTC_ENT38 Putative aminoacrylate peracid reductase RutC OS=Enterobacter sp. (strain 638) GN=rutC PE=3 SV=1 4 123 9.0E-08
sp|Q4ZXR9|RUTC_PSEU2 Putative aminoacrylate peracid reductase RutC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rutC PE=3 SV=1 15 123 1.0E-07
sp|Q32HQ1|RUTC_SHIDS Putative aminoacrylate peracid reductase RutC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|Q1RDK7|RUTC_ECOUT Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain UTI89 / UPEC) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|B1LIZ5|RUTC_ECOSM Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|D2NGI7|RUTC_ECOS5 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O150:H5 (strain SE15) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|P0AFQ5|RUTC_ECOLI Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain K12) GN=rutC PE=1 SV=1 4 123 2.0E-07
sp|B1IV87|RUTC_ECOLC Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|P0AFQ6|RUTC_ECOL6 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rutC PE=1 SV=1 4 123 2.0E-07
sp|Q0TJ57|RUTC_ECOL5 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|D5CZH0|RUTC_ECOKI Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|A1A9R5|RUTC_ECOK1 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O1:K1 / APEC GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|A7ZYW5|RUTC_ECOHS Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O9:H4 (strain HS) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|B1X9D1|RUTC_ECODH Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain K12 / DH10B) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|C9QZ66|RUTC_ECOD1 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIB 12045 / K12 / DH1) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|C4ZQD8|RUTC_ECOBW Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|C6UFC1|RUTC_ECOBR Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain B / REL606) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|C6EHJ7|RUTC_ECOBD Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain B / BL21-DE3) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|B7M8Z5|RUTC_ECO8A Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O8 (strain IAI1) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|B7MTF3|RUTC_ECO81 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O81 (strain ED1a) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|B7NLB6|RUTC_ECO7I Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|B7MIF7|RUTC_ECO45 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|D3H123|RUTC_ECO44 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O44:H18 (strain 042 / EAEC) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|B7UNZ3|RUTC_ECO27 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|A7ZKB5|RUTC_ECO24 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|C8U5H2|RUTC_ECO10 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O103:H2 (strain 12009 / EHEC) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|B6I986|RUTC_ECOSE Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain SE11) GN=rutC PE=3 SV=1 4 123 2.0E-07
sp|P71394|Y1627_HAEIN RutC family protein HI_1627 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1627 PE=3 SV=1 30 123 3.0E-07
sp|B7LFC0|RUTC_ECO55 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain 55989 / EAEC) GN=rutC PE=3 SV=1 4 123 4.0E-07
sp|C8TNC0|RUTC_ECO26 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O26:H11 (strain 11368 / EHEC) GN=rutC PE=3 SV=1 4 123 4.0E-07
sp|C8UMM6|RUTC_ECO1A Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O111:H- (strain 11128 / EHEC) GN=rutC PE=3 SV=1 4 123 4.0E-07
sp|D3QPK3|RUTC_ECOCB Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O55:H7 (strain CB9615 / EPEC) GN=rutC PE=3 SV=1 4 123 4.0E-07
sp|Q8XAU5|RUTC_ECO57 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O157:H7 GN=rutC PE=3 SV=1 4 123 4.0E-07
sp|P0AEB9|YOAB_SHIFL RutC family protein YoaB OS=Shigella flexneri GN=yoaB PE=3 SV=1 50 123 6.0E-06
sp|P0AEB7|YOAB_ECOLI RutC family protein YoaB OS=Escherichia coli (strain K12) GN=yoaB PE=3 SV=1 50 123 6.0E-06
sp|P0AEB8|YOAB_ECOL6 RutC family protein YoaB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yoaB PE=3 SV=1 50 123 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2281
MADQTIVFTKNAPTPLGPYSQAIKTPFAIYCSGQIPLTSEGDMVKGSIADKTDQCCKNLEAVLKEAGSSISKVVK
CNVFLSEMDHFAEMNSVYEKWFSHKPARSCVAVKTLPKNVEVEIEAIALP*
Coding >OphauB2|2281
ATGGCAGACCAGACCATCGTCTTTACCAAAAACGCGCCAACCCCTCTGGGCCCCTATTCCCAGGCTATCAAGACC
CCATTTGCCATCTACTGCTCTGGCCAGATACCTCTGACTTCAGAAGGCGACATGGTCAAGGGATCCATTGCCGAC
AAAACGGACCAGTGTTGCAAAAACCTTGAGGCGGTACTCAAAGAGGCCGGCTCCTCCATATCCAAGGTTGTCAAG
TGCAACGTCTTTCTCTCCGAAATGGACCACTTTGCCGAAATGAATTCTGTCTATGAAAAATGGTTTTCGCATAAG
CCTGCCCGCAGTTGCGTTGCTGTCAAGACACTGCCCAAAAACGTTGAGGTGGAAATTGAGGCCATCGCTCTGCCC
TAA
Transcript >OphauB2|2281
ATGGCAGACCAGACCATCGTCTTTACCAAAAACGCGCCAACCCCTCTGGGCCCCTATTCCCAGGCTATCAAGACC
CCATTTGCCATCTACTGCTCTGGCCAGATACCTCTGACTTCAGAAGGCGACATGGTCAAGGGATCCATTGCCGAC
AAAACGGACCAGTGTTGCAAAAACCTTGAGGCGGTACTCAAAGAGGCCGGCTCCTCCATATCCAAGGTTGTCAAG
TGCAACGTCTTTCTCTCCGAAATGGACCACTTTGCCGAAATGAATTCTGTCTATGAAAAATGGTTTTCGCATAAG
CCTGCCCGCAGTTGCGTTGCTGTCAAGACACTGCCCAAAAACGTTGAGGTGGAAATTGAGGCCATCGCTCTGCCC
TAA
Gene >OphauB2|2281
ATGGCAGACCAGACCATCGTCTTTACCAAAAACGCGCCAACCCGTAAGTCCAGTCATCAGGCTTCATTTGGAACA
ACCACCACTAGTATGGCTGATGACGAGAGGTGTCCTAGCTCTGGGCCCCTATGTGAGTCAAGCATCGCCATGTCA
AAGCCACCTCGATCTGTACGCGTCTTGACTTTTGCATCGCCATACAGTCCCAGGCTATCAAGACCCCATTTGCCA
TCTACTGCTCTGGCCAGATACCTCTGACTTCAGAAGGCGACATGGTCAAGGGATCCATTGCCGACAAAACGGACC
AGTGTTGCAAAAACCTTGAGGCGGTACTCAAAGAGGCCGGCTCCTCCATATCCAAGGTTGTCAAGTGCAACGTCT
TTCTCTCCGAAATGGACCACTTTGCCGTCAGTAAACCTTATTGTGTCCATTGCCTATACATCTCCTAACAACGAG
TTACGGCACATGCAGGAAATGAATTCTGTCTATGAAAAATGGTTTTCGCATAAGCCTGCCCGCAGTTGCGTTGCT
GTCAAGACACTGCCCAAAAACGTTGAGGTGGAAATTGAGGCCATCGCTCTGCCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail