Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2269
Gene name
LocationContig_17:108988..113436
Strand-
Gene length (bp)4448
Transcript length (bp)4290
Coding sequence length (bp)4290
Protein length (aa) 1430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 1.1E-67 1054 1305
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 1.1E-22 54 110
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 4.5E-06 835 921
PF13246 Cation_ATPase Cation transport ATPase (P-type) 9.9E-11 583 668
PF00122 E1-E2_ATPase E1-E2 ATPase 1.1E-06 180 392

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 15 1359 0.0E+00
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 163 1359 0.0E+00
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 57 669 3.0E-100
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 57 669 8.0E-100
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 60 669 3.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 15 1359 0.0E+00
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 163 1359 0.0E+00
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 57 669 3.0E-100
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 57 669 8.0E-100
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 60 669 3.0E-98
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 49 669 4.0E-98
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 51 696 1.0E-95
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 57 669 1.0E-93
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 57 669 2.0E-93
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 47 669 9.0E-93
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 57 669 1.0E-92
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 40 669 4.0E-92
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 33 680 1.0E-90
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 57 672 8.0E-90
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 28 669 2.0E-89
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 53 669 3.0E-89
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 57 669 9.0E-89
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 47 669 4.0E-88
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 28 669 6.0E-87
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 25 669 2.0E-86
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 43 669 4.0E-86
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 57 669 2.0E-85
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 53 670 7.0E-84
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 795 1302 1.0E-83
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 795 1302 2.0E-83
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 34 669 3.0E-83
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 814 1302 1.0E-82
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 815 1263 1.0E-82
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 815 1286 2.0E-82
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 737 1288 4.0E-82
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 57 672 4.0E-82
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 816 1286 5.0E-82
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 812 1305 1.0E-81
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 815 1288 2.0E-81
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 57 669 2.0E-81
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 799 1407 3.0E-81
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 815 1305 5.0E-81
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 815 1213 1.0E-80
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 815 1248 2.0E-80
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 812 1265 7.0E-79
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 57 666 1.0E-78
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 808 1188 6.0E-78
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 806 1164 2.0E-77
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 815 1361 3.0E-77
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 806 1164 7.0E-77
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 806 1164 5.0E-76
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 816 1290 1.0E-75
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 805 1285 9.0E-75
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 815 1287 2.0E-74
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 816 1307 2.0E-74
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 816 1290 6.0E-74
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 55 668 1.0E-73
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 800 1254 2.0E-73
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 816 1290 3.0E-73
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 815 1287 8.0E-73
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 799 1249 4.0E-72
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 808 1254 2.0E-71
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 815 1290 3.0E-71
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 52 457 2.0E-70
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 55 668 2.0E-70
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 14 700 4.0E-70
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 800 1306 5.0E-70
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 55 696 8.0E-70
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 816 1180 3.0E-69
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 15 461 4.0E-69
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 816 1309 6.0E-69
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 821 1313 1.0E-68
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 816 1201 2.0E-68
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 815 1212 2.0E-67
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 817 1184 3.0E-67
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 52 526 3.0E-67
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 816 1247 3.0E-67
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 181 702 4.0E-67
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 22 488 6.0E-67
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 821 1311 6.0E-67
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 181 670 2.0E-66
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 35 704 1.0E-65
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 815 1283 1.0E-65
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 817 1288 1.0E-65
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 181 669 4.0E-65
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 816 1288 1.0E-64
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 60 463 2.0E-64
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 55 463 4.0E-64
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 186 669 1.0E-63
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 39 463 3.0E-63
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 816 1247 5.0E-63
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 57 466 1.0E-62
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 817 1197 7.0E-57
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 34 690 2.0E-56
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 57 728 2.0E-54
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 819 1251 1.0E-53
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 54 458 2.0E-53
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 819 1249 1.0E-52
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 819 1185 6.0E-52
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 819 1193 3.0E-51
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 36 696 7.0E-51
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 60 461 1.0E-50
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 819 1193 1.0E-50
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 819 1304 4.0E-48
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 819 1313 5.0E-48
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 819 1304 5.0E-48
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 60 696 5.0E-47
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 60 696 2.0E-46
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 60 696 3.0E-46
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 52 662 3.0E-46
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 52 662 3.0E-46
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 57 696 4.0E-46
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 819 1182 4.0E-46
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 971 1184 6.0E-46
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 60 696 2.0E-45
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 970 1228 5.0E-41
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 4 146 6.0E-26
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 817 922 6.0E-21
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 817 922 5.0E-20
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 561 696 1.0E-17
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 561 669 2.0E-17
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 564 670 1.0E-15
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 563 690 9.0E-13
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 561 731 5.0E-10
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 57 162 2.0E-09
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 57 143 3.0E-09
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 57 162 4.0E-09
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 803 1050 4.0E-09
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 581 670 6.0E-09
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 815 1050 9.0E-09
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 793 1131 1.0E-08
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 793 1131 2.0E-08
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 750 1054 2.0E-08
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 34 135 5.0E-08
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 803 1050 5.0E-08
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 572 672 6.0E-08
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 581 672 1.0E-07
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 817 1050 1.0E-07
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 581 695 2.0E-07
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 573 673 6.0E-07
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 815 1050 2.0E-06
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 578 670 3.0E-06
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 850 1050 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 97 119 22
2 327 349 22
3 369 391 22
4 1168 1187 19
5 1202 1224 22
6 1236 1258 22
7 1278 1297 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2269
MSATRHGAVKPRPCSLVQRIKSLVGCKQTGADSGSRQIPLAIDPATPLLDARRGRSYVSNKIRTSRYTVWDFVPK
QLLFQFSRVGNFYFLCVGIPQMVPGLSTTGSYTTILPLLFFVMLTMTKEGYDDYRRHRLDKVENAKTTTVLGPQP
CSRAKSAQQPWRTSWSNHEDQAGFAWVPAQWSDVKVGNVVRLSRDEAVPADLVLLHSPDDNGIAYIDTMALDGET
NLKTKQVSRSVDMCSSIEGIAHCHAMFVVEDPNANLFDFNARVTVGAETAPLTLNNVVYRGSILRNTAFVIGLVV
NTGEECKIRINSNQHPRAKRPALETMVNYVVVSLALYIVILSLGVSMGYVKWQHGNEEQAWYLGGASVPFHQIII
AFIIMFNNVVPLSLYISLELVKIGQVILLNSDMEMYHSETDTPARCNTNTILENLGQVGYVFSDKTGTLTDNVMK
FRKLSVAGTVWLHATDILSPHEDRLGSLGFKKPSIAKPCPKHVVAVVQDEAVSSGCQPLPQRSSLGARPSSQWKS
SGRPDHIQPQLTTSDLADYLRLRSRSVFSAKAKSCMLAMALCHTCLPEKRGSKIDFQASSPDELALVRAAQEMGY
AVTRRTRQSITLQTQPVDGEQEGKELTFEILDVIEFSSSRKKMSVIVRYPDGRICLICKGADSTILPRLKLSCLA
MQKASEMRKSADMEREALRRMEQQETRDSLSGFGPSPSLRLSLSMRAHRTRRLGHEPSVKCSRSKSFEVKKMARS
SIDRHPAASAPEPRGTSFDMSKSHARARAHGRDFDQVSSASHPRFDCVDDATRYTDAEVFTRCFKHLDDFATEGL
RTLLYAQKFIPEADYMAWKQTYNEAITSLNDRQQLVEAAADMIEDSLHLVGATAIEDKLQQGVPETIDSLRRANI
KIWMLTGDKRETAVNIAHSARICRPVSNLHVIDAAKGQLGPQLSDLMQNVQASTLLHNVVVIDGQSLAMVEQSPQ
LCKQFFAAMLAVDSVICCRASPAQKALLVRTVGSQLGGFGRGHGRGVTLAIGDGANDVAMIQASHVGIGISGNEG
LQAARVADYAIAQFRHLQRLLLVHGRWNYVRTAKFILCTFWKEMFFYLPTAQYQQYNGYTGTSLYHSVSLTVFNT
LFTSLCTICMGIWEQDVSADTLLALPELYVYGQRNMGLNVLKYARWMALAVLEGIIVWYGVWAGYGSKSPSARDE
GLYALGTLVFTVAILWINCKLLILETHYKPAVVMGSFFITTWGWFAWLAFLDAVVAASPSGPYAVWHSFSRVWGR
DAAWWATLFAVLALLGLVELCGKTVRRQLQLTGAWRLHFWRPWACADATSNIEECDVELWQEMEQDPVVRRRLRK
MARSHVQAGDDDDDDDGNNDNDNDNKVQGDGDDDGKEPKIRPEASSDNSLIWSSSSRMWRRATGKFSIMAATTRR
ASNQ*
Coding >OphauB2|2269
ATGTCGGCAACACGCCATGGTGCCGTCAAGCCGAGACCTTGTTCTCTGGTGCAACGCATCAAATCACTCGTTGGA
TGCAAGCAGACGGGAGCCGACAGTGGGAGCAGGCAAATCCCGCTGGCCATTGACCCCGCGACGCCTTTGCTTGAC
GCCCGCCGCGGCCGCTCATACGTGTCAAACAAGATCCGAACCTCTCGCTACACTGTTTGGGACTTTGTCCCCAAG
CAGCTCTTGTTCCAGTTCTCCCGCGTCGGCAACTTCTACTTTCTTTGCGTCGGCATTCCCCAAATGGTCCCTGGC
CTTTCAACCACGGGCTCGTACACAACCATTCTCCCTCTGCTCTTTTTTGTCATGCTTACAATGACCAAAGAGGGC
TACGATGACTACCGTCGTCACCGTCTGGACAAGGTGGAAAATGCAAAGACGACTACCGTCCTTGGGCCCCAGCCT
TGCAGCAGAGCCAAGTCTGCGCAGCAGCCGTGGCGGACAAGCTGGTCGAATCACGAGGACCAAGCCGGCTTTGCA
TGGGTGCCAGCTCAATGGAGCGACGTCAAGGTCGGCAATGTCGTCAGATTGTCGCGTGATGAAGCCGTCCCTGCC
GACCTTGTCTTGCTGCATAGCCCCGACGACAACGGCATAGCATACATTGACACCATGGCTCTTGACGGCGAGACC
AATCTCAAAACCAAGCAAGTTTCCCGTTCTGTAGACATGTGCAGCTCCATTGAGGGCATAGCACATTGCCACGCC
ATGTTTGTTGTCGAAGACCCCAATGCCAATCTCTTCGACTTCAACGCCCGCGTCACAGTGGGGGCCGAAACGGCC
CCATTGACCCTCAACAACGTGGTGTACAGAGGCAGCATTTTGCGCAACACGGCTTTTGTCATTGGTCTCGTTGTC
AACACAGGAGAGGAATGCAAGATCCGCATCAACTCAAACCAGCATCCTCGTGCCAAGCGCCCTGCTCTCGAGACA
ATGGTCAACTACGTTGTCGTGAGTCTGGCCCTCTACATTGTTATTCTCTCCCTCGGTGTTTCCATGGGCTACGTC
AAATGGCAACATGGCAATGAAGAGCAAGCATGGTACCTGGGTGGTGCAAGTGTCCCTTTCCATCAAATCATCATC
GCCTTCATCATCATGTTCAACAATGTGGTGCCCTTGTCGCTCTACATCAGCCTAGAACTGGTCAAGATTGGACAG
GTGATACTGCTCAATTCTGACATGGAAATGTATCACAGCGAAACGGACACACCGGCACGCTGCAACACAAACACA
ATTCTGGAAAACTTGGGTCAGGTTGGCTACGTCTTCTCGGACAAGACGGGCACTCTGACGGACAATGTCATGAAG
TTTCGCAAACTCAGCGTCGCAGGCACGGTTTGGCTCCATGCCACGGACATCTTGTCCCCGCATGAGGACCGTCTT
GGCAGCCTTGGATTCAAAAAGCCATCCATTGCCAAGCCATGTCCAAAGCATGTTGTGGCCGTAGTCCAAGACGAG
GCAGTGTCTTCTGGATGCCAACCGTTGCCACAAAGGTCGTCTTTGGGCGCAAGGCCGTCTTCTCAATGGAAATCT
AGCGGGCGTCCAGATCACATTCAGCCCCAACTCACAACTTCTGACCTGGCCGACTACCTGAGGTTACGTTCTCGA
TCAGTCTTTTCGGCAAAGGCAAAGAGCTGCATGCTTGCCATGGCCCTCTGTCACACATGTCTCCCTGAGAAGAGG
GGTTCCAAAATCGATTTCCAGGCTTCATCACCGGATGAGCTCGCCTTGGTTAGAGCGGCCCAGGAAATGGGGTAC
GCCGTGACGCGACGCACAAGACAGAGCATTACTCTACAGACTCAGCCAGTCGATGGCGAGCAAGAGGGAAAGGAA
TTGACGTTTGAGATTCTCGACGTGATTGAGTTCAGCAGCTCCCGCAAGAAAATGTCCGTTATTGTCCGCTACCCG
GATGGGCGGATATGTCTAATTTGCAAGGGGGCCGATTCCACCATATTACCTCGGCTCAAGCTGTCGTGTCTGGCA
ATGCAAAAAGCAAGCGAGATGCGTAAGAGCGCTGACATGGAGCGCGAGGCGCTTCGCCGAATGGAGCAGCAAGAG
ACCCGCGACAGTTTGAGCGGTTTTGGTCCGAGTCCAAGTCTGAGGCTGAGTTTAAGTATGAGGGCGCACCGCACT
CGCCGACTTGGGCACGAGCCGAGCGTCAAGTGTAGCAGAAGCAAGTCATTTGAAGTCAAGAAGATGGCCAGGTCG
TCAATTGATAGACATCCGGCAGCCTCGGCCCCTGAGCCACGAGGAACGTCGTTTGATATGTCAAAGAGCCATGCT
CGGGCGCGGGCTCATGGCCGTGATTTTGACCAAGTGTCATCGGCCTCGCACCCTCGATTCGACTGTGTCGATGAT
GCTACCCGATATACAGACGCCGAGGTCTTCACCAGGTGCTTTAAACACTTGGACGACTTTGCTACTGAAGGCCTT
CGCACGCTCTTGTATGCGCAAAAGTTTATTCCAGAAGCCGACTACATGGCATGGAAGCAGACGTACAATGAAGCC
ATCACCAGCCTCAATGACCGCCAGCAACTGGTTGAGGCTGCCGCCGACATGATTGAAGACTCGCTCCACCTTGTG
GGCGCCACGGCAATCGAGGACAAGCTCCAACAGGGCGTTCCCGAGACTATAGACAGCCTTCGGCGCGCCAACATC
AAGATATGGATGCTGACTGGCGACAAGCGTGAGACGGCAGTTAATATTGCCCACTCGGCCCGCATCTGCCGCCCT
GTATCCAATCTTCACGTCATCGACGCAGCCAAAGGCCAACTTGGGCCGCAGCTTTCGGACTTGATGCAGAATGTC
CAAGCCAGCACCTTGCTTCATAACGTTGTTGTCATTGACGGGCAAAGCTTGGCCATGGTGGAGCAATCGCCACAG
CTCTGCAAGCAGTTCTTTGCCGCGATGCTTGCTGTCGACTCGGTCATCTGCTGCAGAGCATCGCCCGCGCAAAAG
GCGCTCTTGGTCCGCACCGTTGGCTCCCAACTGGGCGGCTTTGGCAGAGGCCACGGGAGAGGTGTCACTCTGGCC
ATTGGCGATGGCGCCAATGATGTCGCCATGATTCAGGCCAGCCATGTTGGCATTGGGATATCGGGAAACGAGGGT
CTACAGGCCGCCCGCGTGGCAGACTACGCCATTGCCCAGTTTCGCCATCTTCAGAGGCTTCTTCTGGTTCACGGG
CGATGGAACTATGTGCGCACGGCAAAATTTATACTGTGCACTTTTTGGAAGGAAATGTTTTTCTATTTGCCCACG
GCCCAGTACCAGCAATACAATGGATACACGGGAACCTCTCTCTACCATTCGGTCAGTCTTACCGTCTTTAATACT
CTGTTTACCAGTCTCTGCACTATTTGCATGGGCATCTGGGAGCAAGATGTCAGTGCCGATACGTTGCTGGCTCTT
CCCGAGCTCTATGTCTACGGGCAGCGCAACATGGGACTCAATGTGCTCAAATATGCGCGATGGATGGCTCTGGCC
GTCCTTGAGGGCATTATTGTATGGTACGGCGTTTGGGCGGGCTATGGCAGCAAGTCGCCAAGTGCACGAGACGAG
GGTCTGTATGCCCTGGGGACTCTAGTCTTCACCGTGGCCATTTTGTGGATCAATTGCAAGTTGCTCATTCTCGAG
ACGCATTATAAGCCAGCCGTTGTCATGGGCTCCTTCTTCATCACGACCTGGGGCTGGTTTGCCTGGCTTGCCTTT
CTCGACGCCGTCGTTGCAGCCAGTCCGTCGGGGCCATATGCTGTCTGGCACTCTTTTAGCCGTGTCTGGGGCCGT
GATGCTGCCTGGTGGGCTACTCTGTTTGCAGTCCTCGCTCTTCTCGGCCTCGTTGAGCTTTGTGGAAAGACTGTT
CGGCGCCAGTTGCAGCTGACTGGGGCTTGGCGCTTGCATTTCTGGCGCCCTTGGGCATGTGCTGACGCTACAAGC
AATATTGAGGAATGCGACGTGGAGCTGTGGCAGGAAATGGAACAGGATCCTGTTGTGCGGCGTCGTCTGCGCAAA
ATGGCTCGCAGCCACGTGCAGGCTGGCGACGACGACGACGACGACGACGGCAACAATGACAATGACAATGACAAC
AAGGTGCAAGGCGATGGCGACGACGATGGAAAAGAGCCAAAAATAAGGCCAGAGGCAAGCAGCGACAATTCCTTG
ATTTGGAGCAGCAGCTCGCGCATGTGGAGGCGAGCAACTGGCAAGTTCTCAATAATGGCAGCTACAACCAGGAGG
GCGTCAAACCAGTGA
Transcript >OphauB2|2269
ATGTCGGCAACACGCCATGGTGCCGTCAAGCCGAGACCTTGTTCTCTGGTGCAACGCATCAAATCACTCGTTGGA
TGCAAGCAGACGGGAGCCGACAGTGGGAGCAGGCAAATCCCGCTGGCCATTGACCCCGCGACGCCTTTGCTTGAC
GCCCGCCGCGGCCGCTCATACGTGTCAAACAAGATCCGAACCTCTCGCTACACTGTTTGGGACTTTGTCCCCAAG
CAGCTCTTGTTCCAGTTCTCCCGCGTCGGCAACTTCTACTTTCTTTGCGTCGGCATTCCCCAAATGGTCCCTGGC
CTTTCAACCACGGGCTCGTACACAACCATTCTCCCTCTGCTCTTTTTTGTCATGCTTACAATGACCAAAGAGGGC
TACGATGACTACCGTCGTCACCGTCTGGACAAGGTGGAAAATGCAAAGACGACTACCGTCCTTGGGCCCCAGCCT
TGCAGCAGAGCCAAGTCTGCGCAGCAGCCGTGGCGGACAAGCTGGTCGAATCACGAGGACCAAGCCGGCTTTGCA
TGGGTGCCAGCTCAATGGAGCGACGTCAAGGTCGGCAATGTCGTCAGATTGTCGCGTGATGAAGCCGTCCCTGCC
GACCTTGTCTTGCTGCATAGCCCCGACGACAACGGCATAGCATACATTGACACCATGGCTCTTGACGGCGAGACC
AATCTCAAAACCAAGCAAGTTTCCCGTTCTGTAGACATGTGCAGCTCCATTGAGGGCATAGCACATTGCCACGCC
ATGTTTGTTGTCGAAGACCCCAATGCCAATCTCTTCGACTTCAACGCCCGCGTCACAGTGGGGGCCGAAACGGCC
CCATTGACCCTCAACAACGTGGTGTACAGAGGCAGCATTTTGCGCAACACGGCTTTTGTCATTGGTCTCGTTGTC
AACACAGGAGAGGAATGCAAGATCCGCATCAACTCAAACCAGCATCCTCGTGCCAAGCGCCCTGCTCTCGAGACA
ATGGTCAACTACGTTGTCGTGAGTCTGGCCCTCTACATTGTTATTCTCTCCCTCGGTGTTTCCATGGGCTACGTC
AAATGGCAACATGGCAATGAAGAGCAAGCATGGTACCTGGGTGGTGCAAGTGTCCCTTTCCATCAAATCATCATC
GCCTTCATCATCATGTTCAACAATGTGGTGCCCTTGTCGCTCTACATCAGCCTAGAACTGGTCAAGATTGGACAG
GTGATACTGCTCAATTCTGACATGGAAATGTATCACAGCGAAACGGACACACCGGCACGCTGCAACACAAACACA
ATTCTGGAAAACTTGGGTCAGGTTGGCTACGTCTTCTCGGACAAGACGGGCACTCTGACGGACAATGTCATGAAG
TTTCGCAAACTCAGCGTCGCAGGCACGGTTTGGCTCCATGCCACGGACATCTTGTCCCCGCATGAGGACCGTCTT
GGCAGCCTTGGATTCAAAAAGCCATCCATTGCCAAGCCATGTCCAAAGCATGTTGTGGCCGTAGTCCAAGACGAG
GCAGTGTCTTCTGGATGCCAACCGTTGCCACAAAGGTCGTCTTTGGGCGCAAGGCCGTCTTCTCAATGGAAATCT
AGCGGGCGTCCAGATCACATTCAGCCCCAACTCACAACTTCTGACCTGGCCGACTACCTGAGGTTACGTTCTCGA
TCAGTCTTTTCGGCAAAGGCAAAGAGCTGCATGCTTGCCATGGCCCTCTGTCACACATGTCTCCCTGAGAAGAGG
GGTTCCAAAATCGATTTCCAGGCTTCATCACCGGATGAGCTCGCCTTGGTTAGAGCGGCCCAGGAAATGGGGTAC
GCCGTGACGCGACGCACAAGACAGAGCATTACTCTACAGACTCAGCCAGTCGATGGCGAGCAAGAGGGAAAGGAA
TTGACGTTTGAGATTCTCGACGTGATTGAGTTCAGCAGCTCCCGCAAGAAAATGTCCGTTATTGTCCGCTACCCG
GATGGGCGGATATGTCTAATTTGCAAGGGGGCCGATTCCACCATATTACCTCGGCTCAAGCTGTCGTGTCTGGCA
ATGCAAAAAGCAAGCGAGATGCGTAAGAGCGCTGACATGGAGCGCGAGGCGCTTCGCCGAATGGAGCAGCAAGAG
ACCCGCGACAGTTTGAGCGGTTTTGGTCCGAGTCCAAGTCTGAGGCTGAGTTTAAGTATGAGGGCGCACCGCACT
CGCCGACTTGGGCACGAGCCGAGCGTCAAGTGTAGCAGAAGCAAGTCATTTGAAGTCAAGAAGATGGCCAGGTCG
TCAATTGATAGACATCCGGCAGCCTCGGCCCCTGAGCCACGAGGAACGTCGTTTGATATGTCAAAGAGCCATGCT
CGGGCGCGGGCTCATGGCCGTGATTTTGACCAAGTGTCATCGGCCTCGCACCCTCGATTCGACTGTGTCGATGAT
GCTACCCGATATACAGACGCCGAGGTCTTCACCAGGTGCTTTAAACACTTGGACGACTTTGCTACTGAAGGCCTT
CGCACGCTCTTGTATGCGCAAAAGTTTATTCCAGAAGCCGACTACATGGCATGGAAGCAGACGTACAATGAAGCC
ATCACCAGCCTCAATGACCGCCAGCAACTGGTTGAGGCTGCCGCCGACATGATTGAAGACTCGCTCCACCTTGTG
GGCGCCACGGCAATCGAGGACAAGCTCCAACAGGGCGTTCCCGAGACTATAGACAGCCTTCGGCGCGCCAACATC
AAGATATGGATGCTGACTGGCGACAAGCGTGAGACGGCAGTTAATATTGCCCACTCGGCCCGCATCTGCCGCCCT
GTATCCAATCTTCACGTCATCGACGCAGCCAAAGGCCAACTTGGGCCGCAGCTTTCGGACTTGATGCAGAATGTC
CAAGCCAGCACCTTGCTTCATAACGTTGTTGTCATTGACGGGCAAAGCTTGGCCATGGTGGAGCAATCGCCACAG
CTCTGCAAGCAGTTCTTTGCCGCGATGCTTGCTGTCGACTCGGTCATCTGCTGCAGAGCATCGCCCGCGCAAAAG
GCGCTCTTGGTCCGCACCGTTGGCTCCCAACTGGGCGGCTTTGGCAGAGGCCACGGGAGAGGTGTCACTCTGGCC
ATTGGCGATGGCGCCAATGATGTCGCCATGATTCAGGCCAGCCATGTTGGCATTGGGATATCGGGAAACGAGGGT
CTACAGGCCGCCCGCGTGGCAGACTACGCCATTGCCCAGTTTCGCCATCTTCAGAGGCTTCTTCTGGTTCACGGG
CGATGGAACTATGTGCGCACGGCAAAATTTATACTGTGCACTTTTTGGAAGGAAATGTTTTTCTATTTGCCCACG
GCCCAGTACCAGCAATACAATGGATACACGGGAACCTCTCTCTACCATTCGGTCAGTCTTACCGTCTTTAATACT
CTGTTTACCAGTCTCTGCACTATTTGCATGGGCATCTGGGAGCAAGATGTCAGTGCCGATACGTTGCTGGCTCTT
CCCGAGCTCTATGTCTACGGGCAGCGCAACATGGGACTCAATGTGCTCAAATATGCGCGATGGATGGCTCTGGCC
GTCCTTGAGGGCATTATTGTATGGTACGGCGTTTGGGCGGGCTATGGCAGCAAGTCGCCAAGTGCACGAGACGAG
GGTCTGTATGCCCTGGGGACTCTAGTCTTCACCGTGGCCATTTTGTGGATCAATTGCAAGTTGCTCATTCTCGAG
ACGCATTATAAGCCAGCCGTTGTCATGGGCTCCTTCTTCATCACGACCTGGGGCTGGTTTGCCTGGCTTGCCTTT
CTCGACGCCGTCGTTGCAGCCAGTCCGTCGGGGCCATATGCTGTCTGGCACTCTTTTAGCCGTGTCTGGGGCCGT
GATGCTGCCTGGTGGGCTACTCTGTTTGCAGTCCTCGCTCTTCTCGGCCTCGTTGAGCTTTGTGGAAAGACTGTT
CGGCGCCAGTTGCAGCTGACTGGGGCTTGGCGCTTGCATTTCTGGCGCCCTTGGGCATGTGCTGACGCTACAAGC
AATATTGAGGAATGCGACGTGGAGCTGTGGCAGGAAATGGAACAGGATCCTGTTGTGCGGCGTCGTCTGCGCAAA
ATGGCTCGCAGCCACGTGCAGGCTGGCGACGACGACGACGACGACGACGGCAACAATGACAATGACAATGACAAC
AAGGTGCAAGGCGATGGCGACGACGATGGAAAAGAGCCAAAAATAAGGCCAGAGGCAAGCAGCGACAATTCCTTG
ATTTGGAGCAGCAGCTCGCGCATGTGGAGGCGAGCAACTGGCAAGTTCTCAATAATGGCAGCTACAACCAGGAGG
GCGTCAAACCAGTGA
Gene >OphauB2|2269
ATGTCGGCAACACGCCATGGTGCCGTCAAGCCGAGACCTTGTTCTCTGGTGCAACGCATCAAATCACTCGTTGGA
TGCAAGCAGACGGGAGCCGACAGTGGGAGCAGGCAAATCCCGCTGGCCATTGACCCCGCGACGCCTTTGCTTGAC
GCCCGCCGCGGCCGCTCATACGTGTCAAACAAGATCCGAACCTCTCGCTACACTGTTTGGGACTTTGTCCCCAAG
CAGCTCTTGTTCCAGTTCTCCCGCGTCGGCAACTTCTACTTTCTTTGCGTCGGCATTCCCCAAATGGTGCGTCAC
TACGACACGTGTCGTCTCTGCCGTCAAGGGCTGGCACTGACAGCCATGCCATTTGGCCACTCAAGGTCCCTGGCC
TTTCAACCACGGGCTCGTACACAACCATTCTCCCTCTGCTCTTTTTTGTCATGCTTACAATGACCAAAGAGGGCT
ACGATGACTACCGTCGTCACCGTCTGGACAAGGTGGAAAATGCAAAGACGACTACCGTCCTTGGGCCCCAGCCTT
GCAGCAGAGCCAAGTCTGCGCAGCAGCCGTGGCGGACAAGCTGGTCGAATCACGAGGACCAAGCCGGCTTTGCAT
GGGTGCCAGCTCAATGGAGCGACGTCAAGGTCGGCAATGTCGTCAGATTGTCGCGTGATGAAGCCGTCCCTGCCG
ACCTTGTCTTGCTGCATAGCCCCGACGACAACGGCATAGCATACATTGACACCATGGCTCTTGACGGCGAGACCA
ATCTCAAAACCAAGCAAGTTTCCCGTTCTGTAGACATGTGCAGCTCCATTGAGGGCATAGCACATTGCCACGCCA
TGTTTGTTGTCGAAGACCCCAATGCCAATCTCTTCGACTTCAACGCCCGCGTCACAGTGGGGGCCGAAACGGCCC
CATTGACCCTCAACAACGTGGTGTACAGAGGCAGCATTTTGCGCAACACGGCTTTTGTCATTGGTCTCGTTGTCA
ACACAGGAGAGGAATGCAAGATCCGCATCAACTCAAACCAGCATCCTCGTGCCAAGCGCCCTGCTCTCGAGACAA
TGGTCAACTACGTTGTCGTGAGTCTGGCCCTCTACATTGTTATTCTCTCCCTCGGTGTTTCCATGGGCTACGTCA
AATGGCAACATGGCAATGAAGAGCAAGCATGGTACCTGGGTGGTGCAAGTGTCCCTTTCCATCAAATCATCATCG
CCTTCATCATCATGTTCAACAATGTGGTGCCCTTGTCGCTCTACATCAGCCTAGAACTGGTCAAGATTGGACAGG
TGATACTGCTCAATTCTGACATGGAAATGTATCACAGCGAAACGGACACACCGGCACGCTGCAACACAAACACAA
TTCTGGAAAACTTGGGTCAGGTTGGCTACGTCTTCTCGGACAAGACGGGCACTCTGACGGACAATGTCATGAAGT
TTCGCAAACTCAGCGTCGCAGGCACGGTTTGGCTCCATGCCACGGACATCTTGTCCCCGCATGAGGACCGTCTTG
GCAGCCTTGGATTCAAAAAGCCATCCATTGCCAAGCCATGTCCAAAGCATGTTGTGGCCGTAGTCCAAGACGAGG
CAGTGTCTTCTGGATGCCAACCGTTGCCACAAAGGTCGTCTTTGGGCGCAAGGCCGTCTTCTCAATGGAAATCTA
GCGGGCGTCCAGATCACATTCAGCCCCAACTCACAACTTCTGACCTGGCCGACTACCTGAGGTTACGTTCTCGAT
CAGTCTTTTCGGCAAAGGCAAAGAGCTGCATGCTTGCCATGGCCCTCTGTCACACATGTCTCCCTGAGAAGAGGG
GTTCCAAAATCGATTTCCAGGCTTCATCACCGGATGAGCTCGCCTTGGTTAGAGCGGCCCAGGAAATGGGGTACG
CCGTGACGCGACGCACAAGACAGAGCATTACTCTACAGACTCAGCCAGTCGATGGCGAGCAAGAGGGAAAGGAAT
TGACGTTTGAGATTCTCGACGTGATTGAGTTCAGCAGCTCCCGCAAGAAAATGTCCGTTATTGTCCGCTACCCGG
ATGGGCGGATATGTCTAATTTGCAAGGGGGCCGATTCCACCATATTACCTCGGCTCAAGCTGTCGTGTCTGGCAA
TGCAAAAAGCAAGCGAGATGCGTAAGAGCGCTGACATGGAGCGCGAGGCGCTTCGCCGAATGGAGCAGCAAGAGA
CCCGCGACAGTTTGAGCGGTTTTGGTCCGAGTCCAAGTCTGAGGCTGAGTTTAAGTATGAGGGCGCACCGCACTC
GCCGACTTGGGCACGAGCCGAGCGTCAAGTGTAGCAGAAGCAAGTCATTTGAAGTCAAGAAGATGGCCAGGTCGT
CAATTGATAGACATCCGGCAGCCTCGGCCCCTGAGCCACGAGGAACGTCGTTTGATATGTCAAAGAGCCATGCTC
GGGCGCGGGCTCATGGCCGTGATTTTGACCAAGTGTCATCGGCCTCGCACCCTCGATTCGACTGTGTCGATGATG
CTACCCGATATACAGACGCCGAGGTCTTCACCAGGTGCTTTAAACACTTGGACGACTTTGCTACTGAAGGCCTTC
GCACGCTCTTGTATGCGCAAAAGTTTATTCCAGAAGCCGACTACATGGCATGGAAGCAGACGTACAATGAAGCCA
TCACCAGCCTCAATGACCGCCAGCAACTGGTTGAGGCTGCCGCCGACATGATTGAAGACTCGCTCCACCTTGTGG
GCGCCACGGCAATCGAGGACAAGCTCCAACAGGGCGTTCCCGAGACTATAGACAGCCTTCGGCGCGCCAACATCA
AGATATGGATGCTGACTGGCGACAAGCGTGAGACGGCAGTTAATATTGCCCACTCGGCCCGCATCTGCCGCCCTG
TATCCAATCTTCACGTCATCGACGCAGCCAAAGGCCAACTTGGGCCGCAGCTTTCGGACTTGATGCAGAATGTCC
AAGCCAGCACCTTGCTTCATAACGTTGTTGTCATTGACGGGCAAAGCTTGGCCATGGTGGAGCAATCGCCACAGC
TCTGCAAGCAGTTCTTTGCCGCGATGCTTGCTGTCGACTCGGTCATCTGCTGCAGAGCATCGCCCGCGCAAAAGG
CGCTCTTGGTCCGCACCGTTGGCTCCCAACTGGGCGGCTTTGGCAGAGGCCACGGGAGAGGTGTCACTCTGGCCA
TTGGCGATGGCGCCAATGATGTCGCCATGATTCAGGCCAGCCATGTTGGCATTGGGATATCGGGAAACGAGGGTC
TACAGGCCGCCCGCGTGGCAGACTACGCCATTGCCCAGTTTCGCCATCTTCAGAGGCTTCTTCTGGTTCACGGGC
GATGGAACTATGTGCGCACGGCAAAATTTATACTGTGCACTTTTTGGAAGGAAATGTTTTTCTATTTGCCCACGG
CCCAGTACCAGCAATACAATGGATACACGGGAACCTCTCTCTACCATTCGGTCAGTCTTACCGTCTTTAATACTC
TGTTTACCAGTCTCTGCACTATTTGCATGGGCATCTGGGAGCAAGATGTCAGTGCCGATACGTTGCTGGCTCTTC
CCGAGCTCTATGTCTACGGGCAGCGCAACATGGGACTCAATGTGCTCAAATATGCGCGATGGATGGCTCTGGCCG
TCCTTGAGGGCATTATTGTATGGTACGGCGTTTGGGCGGGCTATGGCAGCAAGTCGCCAAGTGCACGAGACGAGG
GTCTGTATGCCCTGGGGACTCTAGTCTTCACCGTGGCCATTTTGTGGATCAATTGCAAGTTGCTGTGAGTTTCCC
TTTGTTATTTTGGCACGGCAGCATAGCCAGTATTGTGGCTCCTGATCTGATGCCAAAAATGGACAAACACCAGCA
TTCTCGAGACGCATTATAAGCCAGCCGTTGTCATGGGCTCCTTCTTCATCACGACCTGGGGCTGGTTTGCCTGGC
TTGCCTTTCTCGACGCCGTCGTTGCAGCCAGTCCGTCGGGGCCATATGCTGTCTGGCACTCTTTTAGCCGTGTCT
GGGGCCGTGATGCTGCCTGGTGGGCTACTCTGTTTGCAGTCCTCGCTCTTCTCGGCCTCGTTGAGCTTTGTGGAA
AGACTGTTCGGCGCCAGTTGCAGCTGACTGGGGCTTGGCGCTTGCATTTCTGGCGCCCTTGGGCATGTGCTGACG
CTACAAGCAATATTGAGGAATGCGACGTGGAGCTGTGGCAGGAAATGGAACAGGATCCTGTTGTGCGGCGTCGTC
TGCGCAAAATGGCTCGCAGCCACGTGCAGGCTGGCGACGACGACGACGACGACGACGGCAACAATGACAATGACA
ATGACAACAAGGTGCAAGGCGATGGCGACGACGATGGAAAAGAGCCAAAAATAAGGCCAGAGGCAAGCAGCGACA
ATTCCTTGATTTGGAGCAGCAGCTCGCGCATGTGGAGGCGAGCAACTGGCAAGTTCTCAATAATGGCAGCTACAA
CCAGGAGGGCGTCAAACCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail