Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2262
Gene name
LocationContig_17:85090..86939
Strand+
Gene length (bp)1849
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CEX9|BTGE_ASPTN Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgE PE=3 SV=1 82 551 3.0E-68
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 327 552 2.0E-52
sp|Q2US39|BTGE_ASPOR Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgE PE=3 SV=1 327 551 4.0E-51
sp|B8MXP5|BTGE_ASPFN Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgE PE=3 SV=1 327 551 4.0E-51
sp|Q4WC60|BTGE_ASPFU Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgE PE=3 SV=2 327 552 7.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CEX9|BTGE_ASPTN Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgE PE=3 SV=1 82 551 3.0E-68
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 327 552 2.0E-52
sp|Q2US39|BTGE_ASPOR Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgE PE=3 SV=1 327 551 4.0E-51
sp|B8MXP5|BTGE_ASPFN Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgE PE=3 SV=1 327 551 4.0E-51
sp|Q4WC60|BTGE_ASPFU Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgE PE=3 SV=2 327 552 7.0E-51
sp|B0Y9Q9|BTGE_ASPFC Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgE PE=3 SV=2 327 552 7.0E-51
sp|A1C499|BTGE_ASPCL Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgE PE=3 SV=1 327 551 5.0E-49
sp|Q5BD29|BTGE_EMENI Probable beta-glucosidase btgE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=btgE PE=1 SV=1 327 551 8.0E-43
sp|Q2US39|BTGE_ASPOR Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgE PE=3 SV=1 84 223 4.0E-20
sp|B8MXP5|BTGE_ASPFN Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgE PE=3 SV=1 84 223 4.0E-20
sp|P53189|SCW11_YEAST Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW11 PE=1 SV=1 335 551 4.0E-20
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 335 546 1.0E-15
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 334 546 1.0E-14
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 265 546 1.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2262
MKALASATALALLAAGTQAAHHGQGHANVFALRANATASVCVPTCTTIWTTITGAPTLLAMTTTTWTKVNTKTVT
VVKSATLALPTPVTSLMPTPGTYSMPATTVVVDRETTVCGVASTHLLPGIHTLGGLTTVVERPQVVTCPVATLVT
SGSTITSTIVQTEYACPSAGTYTIGPVTTSLLQETDVLYPTPLSYHPGTYTAPASIVVVTVNSYVYYCPLTSSGL
LPSTSVPPAMPTSLYAPPRASKPLPSSVVVVSSPPPAAVPSSSAPVVSSPPPPAAVPSSSAPVVSSPPPPAAVPS
SSAVVLPSLASSTQPSSSRPSPSGKVGSSNDHFGITYTPYQPSNGQCKPAEQVARDIAQLKNAGFTTVRVYSTDC
QTLDHVGSACREHGLDMIVGVFVKESCDTESPDIKEQLKQLAAWDSWHLVKLFLFSLITAVKSQCSKYTGPYTIA
ETLNIWQRPDVSSVLCDAVDVTGANIHPFFNNKVTPETAGDFVAQQLDLLAGICTGNDVINLDSIRQKTGSKTVF
FSYEDDLWKPQSDCACERSWGAAAAFSYAVSQ*
Coding >OphauB2|2262
ATGAAGGCTCTCGCTTCTGCCACGGCCCTGGCGCTGCTGGCCGCGGGCACCCAGGCTGCCCACCACGGCCAGGGC
CATGCCAATGTGTTTGCGCTGAGAGCAAACGCAACGGCCAGTGTCTGCGTGCCCACGTGCACCACCATCTGGACC
ACCATCACCGGAGCGCCCACGCTGCTTGCCATGACCACGACAACATGGACAAAGGTCAACACCAAGACGGTCACG
GTTGTCAAGTCGGCCACCCTTGCCCTGCCCACGCCCGTCACCAGCCTCATGCCCACGCCCGGCACCTACTCCATG
CCCGCCACCACCGTCGTCGTCGACCGCGAGACCACTGTCTGTGGCGTCGCGTCCACGCACCTGCTTCCAGGCATC
CACACTCTGGGCGGCCTCACCACCGTCGTTGAGCGCCCCCAGGTCGTCACCTGCCCCGTCGCCACTCTTGTCACT
TCGGGCTCCACCATCACCAGCACCATTGTCCAGACCGAGTATGCCTGCCCTAGCGCCGGCACCTACACCATTGGT
CCCGTCACCACTTCCCTGCTCCAAGAGACCGATGTGCTGTACCCGACGCCCTTGTCCTACCATCCGGGCACCTAT
ACCGCGCCCGCCAGCATTGTCGTCGTCACGGTAAACAGCTACGTCTACTACTGCCCCCTGACGAGCTCAGGCCTC
TTGCCAAGCACCTCGGTCCCGCCTGCCATGCCCACTTCCCTTTACGCGCCGCCTCGGGCCAGCAAGCCCTTGCCG
AGCTCCGTCGTCGTCGTCTCGAGCCCGCCTCCAGCTGCCGTGCCCTCGAGCTCTGCCCCAGTCGTCTCGAGCCCC
CCTCCTCCAGCTGCCGTGCCCTCGAGCTCTGCCCCAGTCGTCTCGAGCCCCCCTCCTCCAGCTGCCGTGCCCTCG
AGCTCCGCCGTCGTCTTGCCATCGTTGGCCTCGTCCACGCAGCCATCCTCGTCGCGCCCCAGCCCCAGCGGCAAG
GTTGGCAGCTCAAACGACCATTTTGGCATCACCTACACGCCCTACCAGCCCTCCAACGGCCAGTGCAAGCCAGCC
GAGCAGGTGGCGCGCGACATTGCCCAGCTCAAAAACGCCGGCTTCACCACTGTGCGCGTCTACTCGACCGACTGC
CAGACCCTCGACCACGTCGGCTCGGCCTGTCGGGAGCACGGCCTCGACATGATTGTCGGCGTCTTTGTCAAGGAA
AGCTGCGACACTGAATCCCCCGACATCAAGGAGCAGCTCAAGCAGCTCGCCGCCTGGGACTCGTGGCACCTGGTC
AAGCTCTTCCTCTTCAGCCTCATCACGGCCGTCAAGTCGCAGTGCTCCAAGTACACAGGCCCCTACACCATTGCC
GAGACACTCAACATCTGGCAGCGGCCCGATGTCTCGTCGGTTCTGTGCGACGCCGTCGACGTCACGGGCGCCAAC
ATTCACCCCTTCTTCAACAACAAGGTGACGCCCGAAACGGCCGGAGACTTTGTCGCCCAGCAGCTCGACTTGCTC
GCTGGCATCTGCACCGGCAACGACGTCATCAACCTCGACTCCATCCGCCAAAAGACGGGCAGCAAGACCGTCTTC
TTCTCCTACGAGGATGACTTGTGGAAGCCCCAGAGCGACTGTGCCTGCGAGCGGAGCTGGGGTGCCGCCGCCGCC
TTTTCTTATGCCGTCTCCCAGTAA
Transcript >OphauB2|2262
ATGAAGGCTCTCGCTTCTGCCACGGCCCTGGCGCTGCTGGCCGCGGGCACCCAGGCTGCCCACCACGGCCAGGGC
CATGCCAATGTGTTTGCGCTGAGAGCAAACGCAACGGCCAGTGTCTGCGTGCCCACGTGCACCACCATCTGGACC
ACCATCACCGGAGCGCCCACGCTGCTTGCCATGACCACGACAACATGGACAAAGGTCAACACCAAGACGGTCACG
GTTGTCAAGTCGGCCACCCTTGCCCTGCCCACGCCCGTCACCAGCCTCATGCCCACGCCCGGCACCTACTCCATG
CCCGCCACCACCGTCGTCGTCGACCGCGAGACCACTGTCTGTGGCGTCGCGTCCACGCACCTGCTTCCAGGCATC
CACACTCTGGGCGGCCTCACCACCGTCGTTGAGCGCCCCCAGGTCGTCACCTGCCCCGTCGCCACTCTTGTCACT
TCGGGCTCCACCATCACCAGCACCATTGTCCAGACCGAGTATGCCTGCCCTAGCGCCGGCACCTACACCATTGGT
CCCGTCACCACTTCCCTGCTCCAAGAGACCGATGTGCTGTACCCGACGCCCTTGTCCTACCATCCGGGCACCTAT
ACCGCGCCCGCCAGCATTGTCGTCGTCACGGTAAACAGCTACGTCTACTACTGCCCCCTGACGAGCTCAGGCCTC
TTGCCAAGCACCTCGGTCCCGCCTGCCATGCCCACTTCCCTTTACGCGCCGCCTCGGGCCAGCAAGCCCTTGCCG
AGCTCCGTCGTCGTCGTCTCGAGCCCGCCTCCAGCTGCCGTGCCCTCGAGCTCTGCCCCAGTCGTCTCGAGCCCC
CCTCCTCCAGCTGCCGTGCCCTCGAGCTCTGCCCCAGTCGTCTCGAGCCCCCCTCCTCCAGCTGCCGTGCCCTCG
AGCTCCGCCGTCGTCTTGCCATCGTTGGCCTCGTCCACGCAGCCATCCTCGTCGCGCCCCAGCCCCAGCGGCAAG
GTTGGCAGCTCAAACGACCATTTTGGCATCACCTACACGCCCTACCAGCCCTCCAACGGCCAGTGCAAGCCAGCC
GAGCAGGTGGCGCGCGACATTGCCCAGCTCAAAAACGCCGGCTTCACCACTGTGCGCGTCTACTCGACCGACTGC
CAGACCCTCGACCACGTCGGCTCGGCCTGTCGGGAGCACGGCCTCGACATGATTGTCGGCGTCTTTGTCAAGGAA
AGCTGCGACACTGAATCCCCCGACATCAAGGAGCAGCTCAAGCAGCTCGCCGCCTGGGACTCGTGGCACCTGGTC
AAGCTCTTCCTCTTCAGCCTCATCACGGCCGTCAAGTCGCAGTGCTCCAAGTACACAGGCCCCTACACCATTGCC
GAGACACTCAACATCTGGCAGCGGCCCGATGTCTCGTCGGTTCTGTGCGACGCCGTCGACGTCACGGGCGCCAAC
ATTCACCCCTTCTTCAACAACAAGGTGACGCCCGAAACGGCCGGAGACTTTGTCGCCCAGCAGCTCGACTTGCTC
GCTGGCATCTGCACCGGCAACGACGTCATCAACCTCGACTCCATCCGCCAAAAGACGGGCAGCAAGACCGTCTTC
TTCTCCTACGAGGATGACTTGTGGAAGCCCCAGAGCGACTGTGCCTGCGAGCGGAGCTGGGGTGCCGCCGCCGCC
TTTTCTTATGCCGTCTCCCAGTAA
Gene >OphauB2|2262
ATGAAGGCTCTCGCTTCTGCCACGGCCCTGGCGCTGCTGGCCGCGGGCACCCAGGCTGCCCACCACGGCCAGGGC
CATGCCAATGTGTTTGCGCTGAGAGCAAACGCAACGGCCAGTGTCTGCGTGCCCACGTGCACCACCATCTGGACC
ACCATCACCGGAGCGCCCACGCGTAAGCTGCCCGCACCTCTGCTCTCGTGACCCGCTGACGCTTCGCCTCGCAGT
GCTTGCCATGACCACGACAACATGGACAAAGGTCAACACCAAGACGGTCACGGTTGTCAAGTCGGCCACCCTTGC
CCTGCCCACGCCCGTCACCAGCCTCATGCCCACGCCCGGCACCTACTCCATGCCCGCCACCACCGTCGTCGTCGA
CCGCGAGACCACTGTCTGTGGCGTCGCGTCCACGCACCTGCTTCCAGGCATCCACACTCTGGGCGGCCTCACCAC
CGTCGTTGAGCGCCCCCAGGTCGTCACCTGCCCCGTCGCCACTCTTGTCACTTCGGGCTCCACCATCACCAGCAC
CATTGTCCAGACCGAGTATGCCTGCCCTAGCGCCGGCACCTACACCATTGGTCCCGTCACCACTTCCCTGCTCCA
AGAGACCGATGTGCTGTACCCGACGCCCTTGTCCTACCATCCGGGCACCTATACCGCGCCCGCCAGCATTGTCGT
CGTCACGGTAAACAGCTACGTCTACTACTGCCCCCTGACGAGCTCAGGCCTCTTGCCAAGCACCTCGGTCCCGCC
TGCCATGCCCACTTCCCTTTACGCGCCGCCTCGGGCCAGCAAGCCCTTGCCGAGCTCCGTCGTCGTCGTCTCGAG
CCCGCCTCCAGCTGCCGTGCCCTCGAGCTCTGCCCCAGTCGTCTCGAGCCCCCCTCCTCCAGCTGCCGTGCCCTC
GAGCTCTGCCCCAGTCGTCTCGAGCCCCCCTCCTCCAGCTGCCGTGCCCTCGAGCTCCGCCGTCGTCTTGCCATC
GTTGGCCTCGTCCACGCAGCCATCCTCGTCGCGCCCCAGCCCCAGCGGCAAGGTTGGCAGCTCAAACGACCATTT
TGGCATCACCTACACGCCCTACCAGCCCTCCAACGGCCAGTGCAAGCCAGCCGAGCAGGTGGCGCGCGACATTGC
CCAGCTCAAAAACGCCGGCTTCACCACTGTGCGCGTCTACTCGACCGACTGCCAGACCCTCGACCACGTCGGCTC
GGCCTGTCGGGAGCACGGCCTCGACATGATTGTCGGCGTCTTTGTCAAGGAAAGCTGCGACACTGAATCCCCCGA
CATCAAGGAGCAGCTCAAGCAGCTCGCCGCCTGGGACTCGTGGCACCTGGTCAAGCTCTTCGTCGTCGGCAACGA
GGCCATCATGAACGGCCGCTGCTCGCCCCAGCAGCTCTTCAGCCTCATCACGGCCGTCAAGTCGCAGTGCTCCAA
GTACACAGGCCCCTACACCATTGCCGAGACACTCAACATCTGGCAGCGGCCCGATGTCTCGTCGGTTCTGTGCGA
CGCCGTCGACGTCACGGGCGCCAACATTCACCCCTTCTTCAACAACAAGGTGACGCCCGAAACGGCCGGAGACTT
TGTCGCCCAGCAGCTCGACTTGCTCGCTGGCATCTGCACCGGCAACGACGTCATCAACCTCGAGTGCGGCTGGCC
TACCCGCGGCAACTGCAACGGCAGTGCTTGTCCTGGCCAAGAGCAGCAGGCCCAGGCCATCAGCTCCATCCGCCA
AAAGACGGGCAGCAAGACCGTCTTCTTCTCCTACGAGGATGACTTGTGGAAGCCCCAGAGCGACTGTGCCTGCGA
GCGGAGCTGGGGTGCCGCCGCCGCCTTTTCTTATGCCGTCTCCCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail