Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2250
Gene name
LocationContig_17:55091..56060
Strand+
Gene length (bp)969
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01674 Lipase_2 Lipase (class 2) 1.3E-06 75 164

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25275|LIP_PSES5 Lipase OS=Pseudomonas sp. (strain KWI-56) GN=lip PE=1 SV=1 74 203 6.0E-08
sp|P22088|LIP_BURCE Lipase OS=Burkholderia cepacia GN=lipA PE=1 SV=2 74 203 1.0E-07
sp|Q05489|LIP_BURGL Lipase OS=Burkholderia glumae GN=lipA PE=1 SV=1 74 201 2.0E-07

GO

GO Term Description Terminal node
GO:0016042 lipid catabolic process Yes
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0009056 catabolic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2250
MLVSTLLLGLMSLLISLAASSPFYDDMEANRFKQIESTIRAWEKQRKKELKGAGPDEPLFPIRNDWSCKSPRHRN
PIVMLHGLSGTRQLEVNFLELWLRRQGFCTFSFTYGSWSRIMPELPFLGGVRAVDDSSKEIAGFVQQVIAATNSS
KIDIVGHSEGAFLAIYIPRFWPLVGNAANNIIAIGPPTRGTTLRKFFASTLVFGARSRRMWRKVLGKMGCPACDE
LLPDGEPIRRLKAATPVRLPHTTLTIIATRHDRTITPPETAFLYEPGVRNMYIQDDCPADPVEHIGLAVDFNVWN
VVRNVLDKQVDRKYQCVAGLRI*
Coding >OphauB2|2250
ATGCTTGTCTCGACTCTGCTGCTGGGGCTCATGTCCCTGTTGATTAGCCTCGCGGCTAGCTCGCCATTCTACGAC
GACATGGAAGCCAACCGCTTCAAGCAAATCGAATCCACCATCAGGGCGTGGGAGAAGCAGCGCAAAAAGGAACTC
AAGGGCGCCGGCCCCGACGAGCCCCTCTTTCCCATCCGCAATGACTGGTCCTGCAAGAGCCCGCGCCACAGGAAC
CCCATCGTCATGCTCCACGGCCTGTCGGGCACGCGCCAGCTCGAGGTCAACTTTCTCGAGCTGTGGCTTCGCCGC
CAGGGCTTCTGCACCTTTTCCTTCACCTATGGCAGCTGGTCGCGCATCATGCCCGAGCTCCCCTTCCTCGGTGGG
GTCCGCGCCGTCGACGACTCGAGCAAAGAGATTGCAGGCTTTGTCCAGCAGGTCATTGCCGCCACAAACTCGTCC
AAGATTGATATAGTCGGCCACTCCGAGGGCGCCTTTCTCGCCATCTATATCCCTCGCTTCTGGCCTCTGGTGGGC
AATGCCGCCAACAACATCATTGCCATTGGGCCCCCGACTCGCGGCACCACACTGCGCAAGTTTTTTGCCTCGACC
CTCGTCTTTGGCGCTCGAAGCCGTCGCATGTGGCGCAAGGTGCTGGGCAAGATGGGCTGTCCCGCCTGTGACGAA
CTGCTGCCCGATGGCGAGCCCATCAGGCGTCTCAAAGCCGCCACGCCCGTCCGCCTGCCCCATACCACCCTCACC
ATCATTGCCACTCGCCACGACAGGACCATTACACCGCCCGAAACAGCCTTTTTGTACGAGCCCGGCGTCCGCAAC
ATGTACATCCAAGATGATTGCCCGGCCGACCCTGTCGAGCACATTGGCCTTGCCGTCGACTTCAATGTGTGGAAT
GTTGTCCGCAATGTACTCGATAAGCAGGTTGATCGCAAGTATCAGTGTGTCGCCGGCCTTCGCATATAA
Transcript >OphauB2|2250
ATGCTTGTCTCGACTCTGCTGCTGGGGCTCATGTCCCTGTTGATTAGCCTCGCGGCTAGCTCGCCATTCTACGAC
GACATGGAAGCCAACCGCTTCAAGCAAATCGAATCCACCATCAGGGCGTGGGAGAAGCAGCGCAAAAAGGAACTC
AAGGGCGCCGGCCCCGACGAGCCCCTCTTTCCCATCCGCAATGACTGGTCCTGCAAGAGCCCGCGCCACAGGAAC
CCCATCGTCATGCTCCACGGCCTGTCGGGCACGCGCCAGCTCGAGGTCAACTTTCTCGAGCTGTGGCTTCGCCGC
CAGGGCTTCTGCACCTTTTCCTTCACCTATGGCAGCTGGTCGCGCATCATGCCCGAGCTCCCCTTCCTCGGTGGG
GTCCGCGCCGTCGACGACTCGAGCAAAGAGATTGCAGGCTTTGTCCAGCAGGTCATTGCCGCCACAAACTCGTCC
AAGATTGATATAGTCGGCCACTCCGAGGGCGCCTTTCTCGCCATCTATATCCCTCGCTTCTGGCCTCTGGTGGGC
AATGCCGCCAACAACATCATTGCCATTGGGCCCCCGACTCGCGGCACCACACTGCGCAAGTTTTTTGCCTCGACC
CTCGTCTTTGGCGCTCGAAGCCGTCGCATGTGGCGCAAGGTGCTGGGCAAGATGGGCTGTCCCGCCTGTGACGAA
CTGCTGCCCGATGGCGAGCCCATCAGGCGTCTCAAAGCCGCCACGCCCGTCCGCCTGCCCCATACCACCCTCACC
ATCATTGCCACTCGCCACGACAGGACCATTACACCGCCCGAAACAGCCTTTTTGTACGAGCCCGGCGTCCGCAAC
ATGTACATCCAAGATGATTGCCCGGCCGACCCTGTCGAGCACATTGGCCTTGCCGTCGACTTCAATGTGTGGAAT
GTTGTCCGCAATGTACTCGATAAGCAGGTTGATCGCAAGTATCAGTGTGTCGCCGGCCTTCGCATATAA
Gene >OphauB2|2250
ATGCTTGTCTCGACTCTGCTGCTGGGGCTCATGTCCCTGTTGATTAGCCTCGCGGCTAGCTCGCCATTCTACGAC
GACATGGAAGCCAACCGCTTCAAGCAAATCGAATCCACCATCAGGGCGTGGGAGAAGCAGCGCAAAAAGGAACTC
AAGGGCGCCGGCCCCGACGAGCCCCTCTTTCCCATCCGCAATGACTGGTCCTGCAAGAGCCCGCGCCACAGGAAC
CCCATCGTCATGCTCCACGGCCTGTCGGGCACGCGCCAGCTCGAGGTCAACTTTCTCGAGCTGTGGCTTCGCCGC
CAGGGCTTCTGCACCTTTTCCTTCACCTATGGCAGCTGGTCGCGCATCATGCCCGAGCTCCCCTTCCTCGGTGGG
GTCCGCGCCGTCGACGACTCGAGCAAAGAGATTGCAGGCTTTGTCCAGCAGGTCATTGCCGCCACAAACTCGTCC
AAGATTGATATAGTCGGCCACTCCGAGGGCGCCTTTCTCGCCATCTATATCCCTCGCTTCTGGCCTCTGGTGGGC
AATGCCGCCAACAACATCATTGCCATTGGGCCCCCGACTCGCGGCACCACACTGCGCAAGTTTTTTGCCTCGACC
CTCGTCTTTGGCGCTCGAAGCCGTCGCATGTGGCGCAAGGTGCTGGGCAAGATGGGCTGTCCCGCCTGTGACGAA
CTGCTGCCCGATGGCGAGCCCATCAGGCGTCTCAAAGCCGCCACGCCCGTCCGCCTGCCCCATACCACCCTCACC
ATCATTGCCACTCGCCACGACAGGACCATTACACCGCCCGAAACAGCCTTTTTGTACGAGCCCGGCGTCCGCAAC
ATGTACATCCAAGATGATTGCCCGGCCGACCCTGTCGAGCACATTGGCCTTGCCGTCGACTTCAATGTGTGGAAT
GTTGTCCGCAATGTACTCGATAAGCAGGTTGATCGCAAGTATCAGTGTGTCGCCGGCCTTCGCATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail