Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|225
Gene name
LocationContig_10:162956..164007
Strand-
Gene length (bp)1051
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 51 73 22
3 93 115 22
4 128 150 22
5 170 192 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|225
MWDVLFSEYSPGFLQTTTAATLTYAISITFSKLSILAFYLRISPDHKFRIAVFTLIGVVVAYTVTYIFVMVFRCS
PVAAGWDLLLKGRCIDNLIPMMVLSIANILIDLVILCLPLKVVLPLQIPTRQKLSLVLLFATGGFVCAAAIKRTI
IMPPLLASTDYTWNLTEQFIWSFIEVNAGILCASLAALKPLFMRYIPVLIVSRLRSSAVKDSAAVSAPKPDSKSS
TVYGYELPSRDDLPAAKQPQRDDEARLWARGQKAPDAESMDGSEELYPGVKPPRLTVSHGAYGMQSGVDGVKVIK
ETHVSYPN*
Coding >OphauB2|225
ATGTGGGACGTTTTATTCAGTGAATACAGCCCCGGCTTCTTACAGACCACCACGGCCGCTACACTCACCTACGCC
ATATCAATCACCTTTTCCAAGCTCTCCATTCTGGCCTTTTATCTTCGCATCTCCCCGGACCACAAGTTTCGCATC
GCCGTGTTTACGCTTATTGGCGTTGTTGTCGCGTATACTGTTACGTATATTTTCGTCATGGTGTTTCGGTGCAGT
CCTGTTGCGGCGGGTTGGGATCTTTTGCTCAAGGGGAGGTGTATTGACAACTTGATTCCCATGATGGTGCTGAGC
ATTGCGAATATTCTCATTGATCTCGTCATTCTGTGCCTGCCGCTAAAGGTTGTGCTTCCCTTGCAAATTCCCACG
CGGCAAAAGCTCTCTCTTGTTCTTCTCTTTGCCACGGGCGGCTTCGTCTGCGCCGCCGCCATCAAACGCACAATC
ATCATGCCCCCGCTCCTCGCCTCCACAGACTATACATGGAACCTCACCGAGCAATTCATCTGGTCCTTTATCGAA
GTCAACGCCGGCATTCTCTGCGCCTCCCTCGCCGCCCTTAAACCCCTTTTTATGCGCTACATTCCCGTCCTCATT
GTCTCGCGCCTCCGCTCCTCGGCCGTAAAGGACTCGGCTGCCGTGTCGGCGCCCAAGCCCGACTCAAAAAGCAGC
ACCGTCTACGGCTACGAGCTCCCCAGTAGGGATGACTTGCCCGCCGCAAAGCAGCCGCAGCGCGATGATGAGGCT
CGGCTCTGGGCGCGGGGACAAAAGGCGCCGGATGCGGAGAGCATGGATGGCTCAGAGGAGCTGTATCCGGGCGTC
AAGCCGCCGAGGTTGACGGTTAGCCATGGGGCTTATGGGATGCAGTCGGGAGTGGATGGCGTCAAGGTTATAAAG
GAGACGCATGTCTCTTATCCCAACTAG
Transcript >OphauB2|225
ATGTGGGACGTTTTATTCAGTGAATACAGCCCCGGCTTCTTACAGACCACCACGGCCGCTACACTCACCTACGCC
ATATCAATCACCTTTTCCAAGCTCTCCATTCTGGCCTTTTATCTTCGCATCTCCCCGGACCACAAGTTTCGCATC
GCCGTGTTTACGCTTATTGGCGTTGTTGTCGCGTATACTGTTACGTATATTTTCGTCATGGTGTTTCGGTGCAGT
CCTGTTGCGGCGGGTTGGGATCTTTTGCTCAAGGGGAGGTGTATTGACAACTTGATTCCCATGATGGTGCTGAGC
ATTGCGAATATTCTCATTGATCTCGTCATTCTGTGCCTGCCGCTAAAGGTTGTGCTTCCCTTGCAAATTCCCACG
CGGCAAAAGCTCTCTCTTGTTCTTCTCTTTGCCACGGGCGGCTTCGTCTGCGCCGCCGCCATCAAACGCACAATC
ATCATGCCCCCGCTCCTCGCCTCCACAGACTATACATGGAACCTCACCGAGCAATTCATCTGGTCCTTTATCGAA
GTCAACGCCGGCATTCTCTGCGCCTCCCTCGCCGCCCTTAAACCCCTTTTTATGCGCTACATTCCCGTCCTCATT
GTCTCGCGCCTCCGCTCCTCGGCCGTAAAGGACTCGGCTGCCGTGTCGGCGCCCAAGCCCGACTCAAAAAGCAGC
ACCGTCTACGGCTACGAGCTCCCCAGTAGGGATGACTTGCCCGCCGCAAAGCAGCCGCAGCGCGATGATGAGGCT
CGGCTCTGGGCGCGGGGACAAAAGGCGCCGGATGCGGAGAGCATGGATGGCTCAGAGGAGCTGTATCCGGGCGTC
AAGCCGCCGAGGTTGACGGTTAGCCATGGGGCTTATGGGATGCAGTCGGGAGTGGATGGCGTCAAGGTTATAAAG
GAGACGCATGTCTCTTATCCCAACTAG
Gene >OphauB2|225
ATGTGGGACGTTTTATTCAGTGAATACAGCCCCGGCTTCTTACAGGTAAACTTCCTTGCCCTCTTGCTCTCCCGT
ACTTGCTAAACTCGCCTCCAGACCACCACGGCCGCTACACTCACCTACGCCATATCAATCACCTTTTCCAAGCTC
TCCATTCTGGCCTTTTATCTTCGCATCTCCCCGGACCACAAGTTTCGCATCGCCGTGTTTACGCTTATTGGCGTT
GTTGTCGCGTATACTGTTACGTATATTTTCGTCATGGTGTTTCGGTGCAGTCCTGTTGCGGCGGGTTGGGATCTT
TTGCTCAAGGGGAGGTGTATTGACAACTTGATTCCCATGATGGTGCTGAGCATTGCGAATATTCTCATTGATCTC
GTCATTCTGTGCCTGCCGCTAAAGGTTGTGCTTCCCTTGCAAATTCCCACGCGGCAAAAGCTCTCTCTTGTTCTT
CTCTTTGCCACGGGCGGCTTGTAAGTCGATACTTACCCTTCCTACTCTACTCTCCAAAACCACTCGAATTACTTT
CTAACAAACACCCTCTAGCGTCTGCGCCGCCGCCATCAAACGCACAATCATCATGCCCCCGCTCCTCGCCTCCAC
AGACTATACATGGAACCTCACCGAGCAATTCATCTGGTCCTTTATCGAAGTCAACGCCGGCATTCTCTGCGCCTC
CCTCGCCGCCCTTAAACCCCTTTTTATGCGCTACATTCCCGTCCTCATTGTCTCGCGCCTCCGCTCCTCGGCCGT
AAAGGACTCGGCTGCCGTGTCGGCGCCCAAGCCCGACTCAAAAAGCAGCACCGTCTACGGCTACGAGCTCCCCAG
TAGGGATGACTTGCCCGCCGCAAAGCAGCCGCAGCGCGATGATGAGGCTCGGCTCTGGGCGCGGGGACAAAAGGC
GCCGGATGCGGAGAGCATGGATGGCTCAGAGGAGCTGTATCCGGGCGTCAAGCCGCCGAGGTTGACGGTTAGCCA
TGGGGCTTATGGGATGCAGTCGGGAGTGGATGGCGTCAAGGTTATAAAGGAGACGCATGTCTCTTATCCCAACTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail