Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2245
Gene name
LocationContig_17:36468..38289
Strand+
Gene length (bp)1821
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 2.8E-36 52 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53730|ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG12 PE=1 SV=1 32 446 2.0E-54
sp|Q8VDB2|ALG12_MOUSE Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Mus musculus GN=Alg12 PE=2 SV=2 36 392 3.0E-54
sp|A8MR93|ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana GN=ALG12 PE=1 SV=1 19 388 5.0E-54
sp|Q9VH78|ALG12_DROME Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Drosophila melanogaster GN=CG8412 PE=2 SV=1 33 387 7.0E-54
sp|Q23361|ALG12_CAEEL Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Caenorhabditis elegans GN=ZC513.5 PE=1 SV=2 48 395 7.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53730|ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG12 PE=1 SV=1 32 446 2.0E-54
sp|Q8VDB2|ALG12_MOUSE Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Mus musculus GN=Alg12 PE=2 SV=2 36 392 3.0E-54
sp|A8MR93|ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana GN=ALG12 PE=1 SV=1 19 388 5.0E-54
sp|Q9VH78|ALG12_DROME Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Drosophila melanogaster GN=CG8412 PE=2 SV=1 33 387 7.0E-54
sp|Q23361|ALG12_CAEEL Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Caenorhabditis elegans GN=ZC513.5 PE=1 SV=2 48 395 7.0E-49
sp|Q9BV10|ALG12_HUMAN Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Homo sapiens GN=ALG12 PE=1 SV=1 38 392 3.0E-46
sp|Q9USD4|ALG12_SCHPO Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg12 PE=3 SV=2 48 445 4.0E-46
sp|Q6FTY5|GPI10_CANGA GPI mannosyltransferase 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI10 PE=3 SV=1 150 364 5.0E-11
sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio GN=pigb PE=2 SV=1 2 399 2.0E-09
sp|Q4V7R2|PIGB_XENLA GPI mannosyltransferase 3 OS=Xenopus laevis GN=pigb PE=2 SV=1 89 373 2.0E-07
sp|Q75BG9|GPI10_ASHGO GPI mannosyltransferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI10 PE=3 SV=1 86 353 1.0E-06
sp|Q4IB63|GPI10_GIBZE GPI mannosyltransferase 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI10 PE=3 SV=1 192 352 1.0E-06
sp|Q6CN76|GPI10_KLULA GPI mannosyltransferase 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPI10 PE=3 SV=1 219 355 2.0E-06
sp|Q5AK24|GPI10_CANAL GPI mannosyltransferase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI10 PE=3 SV=1 116 394 3.0E-06
sp|Q9USN0|GPI10_SCHPO GPI mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi10 PE=3 SV=1 224 352 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

Domain # Start End Length
1 81 100 19
2 115 132 17
3 139 161 22
4 198 220 22
5 233 255 22
6 314 331 17
7 338 360 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2245
MKHKARDQASKTRALWQRTARSMGRVVGSEMAIDSLMVGMGLLHLVASPHTKVEESFNLQAAHDMMVYGRTGVAQ
GAYDHFVFAGAVPRSFVGAALLAGVAKPLVWATGFQHAQFVVRGLLAAANAASLVLLRRALLRAAGAPAATWCGL
LMLGQFHVWYYLSRTLPNMLAFGPTTAAFALLLQPGPAAPRRALALLALAAAVLRAELALLLAATGLYLLARRAL
SLRALARVVVVATALALALSLPLDSYLWQRPLWPELAAFYFNALLGSASRWGIQPWHYYLTSALPRLLLNPLLLP
LAVLALRHPATRRTALPLLVPSLLYLALYSLQPHKETRFVLYLVPPLTAVAALGAARITARRSNLAMLALSSLNY
PGGDALAQLRALARHQSPAPPRPLRNPDGLPLALLSAHAQQPFLLFDRTEDPAQLAQPAFWLDFDYALAEHLRFL
GPDTPDEPLHHHRLLGRGAHVASLRRALRPWTGGWWLGPRMTPRIHILKRRPESSAAAAL*
Coding >OphauB2|2245
ATGAAGCACAAGGCAAGGGACCAGGCGTCCAAGACAAGGGCATTGTGGCAGAGGACAGCAAGGAGCATGGGGCGC
GTGGTGGGGAGCGAGATGGCGATTGACAGCCTCATGGTGGGCATGGGGCTGCTGCACCTGGTGGCATCGCCGCAC
ACCAAGGTGGAGGAATCCTTCAACCTGCAAGCGGCGCACGACATGATGGTGTACGGGCGGACAGGCGTGGCGCAA
GGGGCCTACGACCACTTTGTCTTTGCGGGAGCGGTGCCGCGCAGCTTTGTGGGAGCGGCGCTGCTGGCGGGCGTG
GCCAAGCCGCTGGTGTGGGCGACGGGCTTCCAGCACGCGCAGTTTGTGGTGCGCGGGCTGCTGGCGGCGGCCAAT
GCTGCCAGCCTGGTGCTGCTGCGTCGCGCCCTGCTGCGCGCTGCCGGAGCGCCCGCCGCGACGTGGTGCGGCCTG
CTGATGCTGGGCCAGTTCCACGTCTGGTACTACCTGTCGCGCACCCTGCCCAACATGCTTGCCTTTGGCCCCACC
ACGGCCGCCTTTGCCCTGCTGCTGCAGCCCGGCCCGGCCGCCCCCCGCCGCGCCCTCGCCCTGCTGGCCCTGGCT
GCTGCCGTCTTGCGCGCCGAGCTGGCCCTCTTGCTCGCCGCCACGGGCCTCTACTTGCTCGCCCGCCGCGCCCTG
TCCCTGCGCGCCCTGGCCCGCGTCGTCGTCGTGGCCACGGCCCTCGCCCTGGCCCTCTCCCTGCCCCTCGACTCG
TACCTTTGGCAGAGGCCGCTGTGGCCCGAGCTCGCCGCCTTTTACTTCAACGCCCTCTTGGGCTCCGCCTCGCGC
TGGGGCATCCAGCCCTGGCACTACTACCTGACGTCGGCCCTGCCCCGTCTGCTGCTCAACCCGCTTCTGCTGCCC
CTGGCTGTCCTGGCCCTGCGCCACCCCGCCACCAGGCGCACCGCCCTGCCGCTGCTTGTCCCCAGCCTGCTCTAC
CTGGCCCTCTACTCGCTGCAGCCCCACAAGGAGACGCGCTTCGTCTTGTACCTGGTGCCGCCTCTGACGGCCGTT
GCCGCCCTGGGCGCCGCCCGCATTACCGCCCGCCGCTCCAACCTGGCCATGCTGGCCCTCTCGTCGCTCAACTAC
CCTGGCGGCGATGCCCTGGCCCAGCTCCGCGCCCTGGCCCGCCACCAGTCGCCAGCCCCGCCCCGGCCCCTGCGC
AACCCAGACGGCCTGCCCCTGGCCCTCTTGTCTGCCCACGCCCAGCAGCCCTTTTTGCTCTTTGACAGGACCGAG
GACCCTGCCCAGCTGGCCCAGCCAGCCTTTTGGCTTGACTTTGACTACGCCCTGGCCGAGCATCTCCGATTTCTT
GGCCCGGACACCCCCGACGAGCCCCTGCACCACCACCGCCTGCTCGGCCGCGGCGCCCACGTTGCCTCTCTCCGG
CGTGCTCTTCGCCCTTGGACCGGCGGCTGGTGGCTTGGCCCACGCATGACACCGCGCATTCACATTCTTAAGCGT
CGCCCTGAATCCAGTGCTGCCGCCGCCCTTTAG
Transcript >OphauB2|2245
ATGAAGCACAAGGCAAGGGACCAGGCGTCCAAGACAAGGGCATTGTGGCAGAGGACAGCAAGGAGCATGGGGCGC
GTGGTGGGGAGCGAGATGGCGATTGACAGCCTCATGGTGGGCATGGGGCTGCTGCACCTGGTGGCATCGCCGCAC
ACCAAGGTGGAGGAATCCTTCAACCTGCAAGCGGCGCACGACATGATGGTGTACGGGCGGACAGGCGTGGCGCAA
GGGGCCTACGACCACTTTGTCTTTGCGGGAGCGGTGCCGCGCAGCTTTGTGGGAGCGGCGCTGCTGGCGGGCGTG
GCCAAGCCGCTGGTGTGGGCGACGGGCTTCCAGCACGCGCAGTTTGTGGTGCGCGGGCTGCTGGCGGCGGCCAAT
GCTGCCAGCCTGGTGCTGCTGCGTCGCGCCCTGCTGCGCGCTGCCGGAGCGCCCGCCGCGACGTGGTGCGGCCTG
CTGATGCTGGGCCAGTTCCACGTCTGGTACTACCTGTCGCGCACCCTGCCCAACATGCTTGCCTTTGGCCCCACC
ACGGCCGCCTTTGCCCTGCTGCTGCAGCCCGGCCCGGCCGCCCCCCGCCGCGCCCTCGCCCTGCTGGCCCTGGCT
GCTGCCGTCTTGCGCGCCGAGCTGGCCCTCTTGCTCGCCGCCACGGGCCTCTACTTGCTCGCCCGCCGCGCCCTG
TCCCTGCGCGCCCTGGCCCGCGTCGTCGTCGTGGCCACGGCCCTCGCCCTGGCCCTCTCCCTGCCCCTCGACTCG
TACCTTTGGCAGAGGCCGCTGTGGCCCGAGCTCGCCGCCTTTTACTTCAACGCCCTCTTGGGCTCCGCCTCGCGC
TGGGGCATCCAGCCCTGGCACTACTACCTGACGTCGGCCCTGCCCCGTCTGCTGCTCAACCCGCTTCTGCTGCCC
CTGGCTGTCCTGGCCCTGCGCCACCCCGCCACCAGGCGCACCGCCCTGCCGCTGCTTGTCCCCAGCCTGCTCTAC
CTGGCCCTCTACTCGCTGCAGCCCCACAAGGAGACGCGCTTCGTCTTGTACCTGGTGCCGCCTCTGACGGCCGTT
GCCGCCCTGGGCGCCGCCCGCATTACCGCCCGCCGCTCCAACCTGGCCATGCTGGCCCTCTCGTCGCTCAACTAC
CCTGGCGGCGATGCCCTGGCCCAGCTCCGCGCCCTGGCCCGCCACCAGTCGCCAGCCCCGCCCCGGCCCCTGCGC
AACCCAGACGGCCTGCCCCTGGCCCTCTTGTCTGCCCACGCCCAGCAGCCCTTTTTGCTCTTTGACAGGACCGAG
GACCCTGCCCAGCTGGCCCAGCCAGCCTTTTGGCTTGACTTTGACTACGCCCTGGCCGAGCATCTCCGATTTCTT
GGCCCGGACACCCCCGACGAGCCCCTGCACCACCACCGCCTGCTCGGCCGCGGCGCCCACGTTGCCTCTCTCCGG
CGTGCTCTTCGCCCTTGGACCGGCGGCTGGTGGCTTGGCCCACGCATGACACCGCGCATTCACATTCTTAAGCGT
CGCCCTGAATCCAGTGCTGCCGCCGCCCTTTAG
Gene >OphauB2|2245
ATGAAGCACAAGGCAAGGGACCAGGCGTCCAAGACAAGGGCATTGTGGCAGAGGACAGCAAGGAGCATGGGGCGC
GTGGTGGGTGAGTCGGCAGAGGGCGTGGGCTGGGTTGAGGAGGCTTTTGCTGACGAGGAGAATGGGAGACAGGGA
GCGAGATGGCGATTGACAGCCTCATGGTGGGCATGGGGCTGCTGCACCTGGTGGCATCGCCGCACACCAAGGTGG
AGGAATCCTTCAACCTGCAAGCGGCGCACGACATGATGGTGTACGGGCGGACAGGCGTGGCGCAAGGGGCCTACG
ACCACTTTGTCTTTGCGGGAGCGGTGCCGCGCAGCTTTGTGGGAGCGGCGCTGCTGGCGGGCGTGGCCAAGCCGC
TGGTGTGGGCGACGGGCTTCCAGCACGCGCAGTTTGTGGTGCGCGGGCTGCTGGCGGCGGCCAATGCTGCCAGCC
TGGTGCTGCTGCGTCGCGCCCTGCTGCGCGCTGCCGGAGCGCCCGCCGCGACGTGGTGCGGCCTGCTGATGCTGG
GCCAGTTCCACGTCTGGTACTACCTGTCGCGCACCCTGCCCAACATGCTTGCCTTTGGCCCCAGTGCGTTGCCCT
CGTTGTCCCACGCGCCGCCAGAGTGCTGACTGGCCAGCCACGGCCGCCTTTGCCCTGCTGCTGCAGCCCGGCCCG
GCCGCCCCCCGCCGCGCCCTCGCCCTGCTGGCCCTGGCTGCTGCCGTCTTGCGCGCCGAGCTGGCCCTCTTGCTC
GCCGCCACGGGCCTCTACTTGCTCGCCCGCCGCGCCCTGTCCCTGCGCGCCCTGGCCCGCGTCGTCGTCGTGGCC
ACGGCCCTCGCCCTGGCCCTCTCCCTGCCCCTCGACTCGTACCTTTGGCAGAGGCCGCTGTGGCCCGAGCTCGCC
GCCTTTTACTTCAACGCCCTCTTGGGCTCCGCCTCGCGCTGGGGCATCCAGCCCTGGCACTACTACCTGACGTCG
GCCCTGCCCCGTCTGCTGCTCAACCCGCTTCTGCTGCCCCTGGCTGTCCTGGCCCTGCGCCACCCCGCCACCAGG
CGCACCGCCCTGCCGCTGCTTGTCCCCAGCCTGCTCTACCTGGCCCTCTACTCGCTGCAGCCCCACAAGGAGACG
CGCTTCGTCTTGTACCTGGTGCCGCCTCTGACGGCCGTTGCCGCCCTGGGCGCCGCCCGCATTACCGCCCGCCGC
TCCAAGTCGCCCCTCTGCCGCCTCGCCACCCTGCTCCTCGCCGCCTCCCTCGTGGCCTGCGTCGCTGCCAGCCTG
GCCATGCTGGCCCTCTCGTCGCTCAACTACCCTGGCGGCGATGCCCTGGCCCAGCTCCGCGCCCTGGCCCGCCAC
CAGTCGCCAGCCCCGCCCCGGCCCCTGCGCGTCCACGCCGATGTCTTGACTTGCATGACGGGCCTGACTCTGTTT
GGCCAGAACCCAGACGGCCTGCCCCTGGCCCTCTTGTCTGCCCACGCCCAGCAGCCCTTTTTGCTCTTTGACAGG
ACCGAGGACCCTGCCCAGCTGGCCCAGCCAGCCTTTTGGCTTGACTTTGACTACGCCCTGGCCGAGCATCTCCGA
GTGCCCCTTGGCGCCTGGGATGTTGTCGGTGTCGTTGCCGGCTTTGACGGCCTACAGTTTCTTGGCCCGGACACC
CCCGACGAGCCCCTGCACCACCACCGCCTGCTCGGCCGCGGCGCCCACGTTGCCTCTCTCCGGCGTGCTCTTCGC
CCTTGGACCGGCGGCTGGTGGCTTGGCCCACGCATGACACCGCGCATTCACATTCTTAAGCGTCGCCCTGAATCC
AGTGCTGCCGCCGCCCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail