Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2239
Gene name
LocationContig_17:23986..25306
Strand+
Gene length (bp)1320
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 7.4E-17 8 236
PF04321 RmlD_sub_bind RmlD substrate binding domain 6.7E-08 8 197

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2239
MANDKPSVLIIGGLGYIGRFLALYIHEKQLASEIRLVDKVLPQLAWLAPEFAEACSQDKFMQADASRAEALARIF
DRSNAKEWDWVFNCGGETRYSQDDEVYKLRSLNLSLAVGREAAKRKVKVFVELSTGMVYKSDSQPSKEKDKLKPW
SKIAVFKLQAEEELSKIEGLNLVIVRLPHVYGPYASQWIGTALCMARVYQHLEGEMKWLWSKDLRTNTVHIHDTT
RALWAIAAWFVAGKVNWNRAETGPVPIFNVVDKGETTQGTIAAVIGDLFNIETGFQGQFISTFARLNLDHVVDDV
NEETLGPWAKLLHTADITRPGPLSPFMEKELLKDTDLSMDGSLLEKVVGFEYEKPAVSRKLVQEVIESYKKMKWW
P*
Coding >OphauB2|2239
ATGGCCAACGACAAGCCGTCAGTCCTCATCATCGGGGGCCTCGGCTACATTGGCCGCTTTCTGGCGCTCTACATC
CACGAGAAGCAGTTGGCGTCGGAGATCCGGCTGGTGGACAAGGTGCTGCCTCAGCTTGCATGGCTGGCTCCCGAA
TTCGCCGAGGCGTGCTCCCAAGACAAATTCATGCAAGCCGACGCCAGCAGAGCCGAGGCCCTCGCTCGAATATTC
GATCGCTCCAATGCTAAGGAGTGGGACTGGGTCTTCAACTGCGGAGGCGAGACGCGATATTCGCAAGATGACGAA
GTCTATAAGCTCCGGTCGCTCAATCTGTCGCTAGCTGTCGGTAGGGAGGCGGCCAAGCGCAAGGTCAAGGTGTTT
GTTGAACTCAGCACGGGTATGGTCTACAAGTCCGACTCGCAACCCAGCAAGGAGAAGGACAAGCTCAAACCATGG
AGTAAAATCGCCGTCTTCAAGCTGCAGGCAGAGGAGGAGCTGTCTAAGATTGAGGGACTAAACCTCGTCATTGTG
CGCTTGCCTCATGTTTATGGTCCGTATGCTTCGCAATGGATTGGGACAGCATTGTGCATGGCGCGCGTCTATCAG
CACCTCGAAGGCGAAATGAAGTGGCTATGGTCAAAAGATCTGCGGACAAACACTGTTCATATTCACGACACGACG
CGCGCCCTCTGGGCCATTGCTGCATGGTTTGTTGCAGGCAAGGTCAACTGGAATAGGGCCGAGACGGGCCCGGTA
CCCATATTCAACGTGGTGGACAAGGGCGAAACGACCCAAGGCACTATTGCCGCTGTCATTGGCGATCTTTTCAAC
ATTGAGACGGGCTTCCAGGGCCAGTTCATCAGCACCTTTGCCCGGCTCAATCTCGACCACGTCGTCGACGATGTC
AATGAGGAGACGCTGGGCCCGTGGGCAAAGCTGCTCCACACAGCCGATATCACGCGCCCAGGTCCACTGTCCCCC
TTTATGGAAAAGGAACTTCTCAAGGACACGGACCTTAGTATGGACGGAAGCCTGCTGGAAAAGGTGGTGGGCTTC
GAGTACGAGAAACCGGCCGTGTCTAGGAAATTGGTGCAAGAGGTGATTGAGAGTTACAAGAAGATGAAGTGGTGG
CCTTGA
Transcript >OphauB2|2239
ATGGCCAACGACAAGCCGTCAGTCCTCATCATCGGGGGCCTCGGCTACATTGGCCGCTTTCTGGCGCTCTACATC
CACGAGAAGCAGTTGGCGTCGGAGATCCGGCTGGTGGACAAGGTGCTGCCTCAGCTTGCATGGCTGGCTCCCGAA
TTCGCCGAGGCGTGCTCCCAAGACAAATTCATGCAAGCCGACGCCAGCAGAGCCGAGGCCCTCGCTCGAATATTC
GATCGCTCCAATGCTAAGGAGTGGGACTGGGTCTTCAACTGCGGAGGCGAGACGCGATATTCGCAAGATGACGAA
GTCTATAAGCTCCGGTCGCTCAATCTGTCGCTAGCTGTCGGTAGGGAGGCGGCCAAGCGCAAGGTCAAGGTGTTT
GTTGAACTCAGCACGGGTATGGTCTACAAGTCCGACTCGCAACCCAGCAAGGAGAAGGACAAGCTCAAACCATGG
AGTAAAATCGCCGTCTTCAAGCTGCAGGCAGAGGAGGAGCTGTCTAAGATTGAGGGACTAAACCTCGTCATTGTG
CGCTTGCCTCATGTTTATGGTCCGTATGCTTCGCAATGGATTGGGACAGCATTGTGCATGGCGCGCGTCTATCAG
CACCTCGAAGGCGAAATGAAGTGGCTATGGTCAAAAGATCTGCGGACAAACACTGTTCATATTCACGACACGACG
CGCGCCCTCTGGGCCATTGCTGCATGGTTTGTTGCAGGCAAGGTCAACTGGAATAGGGCCGAGACGGGCCCGGTA
CCCATATTCAACGTGGTGGACAAGGGCGAAACGACCCAAGGCACTATTGCCGCTGTCATTGGCGATCTTTTCAAC
ATTGAGACGGGCTTCCAGGGCCAGTTCATCAGCACCTTTGCCCGGCTCAATCTCGACCACGTCGTCGACGATGTC
AATGAGGAGACGCTGGGCCCGTGGGCAAAGCTGCTCCACACAGCCGATATCACGCGCCCAGGTCCACTGTCCCCC
TTTATGGAAAAGGAACTTCTCAAGGACACGGACCTTAGTATGGACGGAAGCCTGCTGGAAAAGGTGGTGGGCTTC
GAGTACGAGAAACCGGCCGTGTCTAGGAAATTGGTGCAAGAGGTGATTGAGAGTTACAAGAAGATGAAGTGGTGG
CCTTGA
Gene >OphauB2|2239
ATGGCCAACGACAAGCCGTCAGTCCTCATCATCGGGGGCCTCGGCTACATTGGCCGCTTTCTGGCGCTCTACATC
CACGAGAAGCAGTTGGCGTCGGAGATCCGGCTGGTGGACAAGGTGCTGCCTCAGCTTGCATGGCTGGCTCCCGAA
TTCGCCGAGGCGTGCTCCCAAGACAAATTCATGCAAGCCGACGCCAGCAGAGCCGGTCAGTAGCAACGCACCCGC
ATATGCGCATGCATCCCCCCATGATGGTGCCTGCAGCTCACTCCATCGATTCCCTCCCTAATTAAACTGGCATGC
AAATGTGCAGACTGCTGACGCTTGCGCAGAGGCCCTCGCTCGAATATTCGATCGCTCCAATGCTAAGGAGTGGGA
CTGGGTCTTCAACTGCGGAGGCGAGACGCGATATTCGCAAGATGACGAAGTCTATAAGCTCCGGTCGCTCAATCT
GTCGCTAGCTGTCGGTAGGGAGGCGGCCAAGCGCAAGGTCAAGGTGTTTGTTGAACTCAGCACGGGTATGGTCTA
CAAGTCCGACTCGCAACCCAGCAAGGAGAAGGACAAGCTCAAACCATGGAGTAAAATCGCCGTCTTCAAGCTGCA
GGCAGAGGAGGAGCTGTCTAAGATTGAGGGGCAAGTGTCACGAGTACATTTGGTCCAGAGATGGCAAAAACGCTG
ACTGCATCTGCGCCATACAGACTAAACCTCGTCATTGTGCGCTTGCCTCATGTTTATGGTCCGTATGCTTCGCAA
TGGATTGGGACAGCATTGTGCATGGCGCGCGTCTATCAGCACCTCGAAGGCGAAATGAAGTGGCTATGGTCAAAA
GATCTGCGGACAAACACTGTTCATATTCACGACACGACGCGCGCCCTCTGGGCCATTGCTGCATGGTTTGTTGCA
GGCAAGGTCAACTGGAATAGGGCCGAGACGGGCCCGGTACCCATATTCAACGTGGTGGACAAGGGCGAAACGACC
CAAGGCACTATTGCCGCTGTCATTGGCGATCTTTTCAACATTGAGACGGGCTTCCAGGGCCAGTTCATCAGCACC
TTTGCCCGGCTCAATCTCGACCACGTCGTCGACGATGTCAATGAGGAGACGCTGGGCCCGTGGGCAAAGCTGCTC
CACACAGCCGATATCACGCGCCCAGGTCCACTGTCCCCCTTTATGGAAAAGGAACTTCTCAAGGACACGGACCTT
AGTATGGACGGAAGCCTGCTGGAAAAGGTGGTGGGCTTCGAGTACGAGAAACCGGCCGTGTCTAGGAAATTGGTG
CAAGAGGTGATTGAGAGTTACAAGAAGATGAAGTGGTGGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail