Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2230
Gene name
LocationContig_17:6086..6860
Strand-
Gene length (bp)774
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06127 Mpo1-like 2-hydroxy-palmitic acid dioxygenase Mpo1-like 1.1E-27 4 159

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13737|YDR2_SCHPO Uncharacterized endoplasmic reticulum membrane protein C16E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.02 PE=4 SV=2 5 176 3.0E-26
sp|P25338|YGB0_YEAST Uncharacterized endoplasmic reticulum membrane protein YGL010W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL010W PE=1 SV=2 3 185 2.0E-23

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 57 76 19
3 80 99 19
4 106 125 19
5 140 162 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2230
MSLDLERHLTFYGAYHHNSVNVAIHMVCVPLILVSAFCLATYTGTLIEAPLWLTGPYLHLNLGTMAAVGYAALYV
LLEPVAGFVLAAFCIGSAALANFLRMEDSKTTWHYALAIHIVSWVAQFVGHGAFEGRAPALLDNLAQALFLAPMF
VWLELLFKLGYRRELQRRVDKRVQVEIAKFRAASKGGKAGSRPSGASKARRGE*
Coding >OphauB2|2230
ATGTCGCTTGATCTGGAGCGGCATTTAACCTTTTATGGCGCCTATCACCACAACTCGGTCAACGTGGCCATTCAC
ATGGTGTGCGTGCCCCTGATTCTCGTCTCGGCCTTTTGCTTGGCTACCTACACAGGCACCTTGATTGAGGCGCCT
CTCTGGCTCACGGGGCCCTATCTCCATCTCAACCTGGGCACCATGGCAGCGGTTGGCTATGCGGCCCTCTACGTC
TTGCTCGAGCCCGTGGCAGGCTTCGTCCTGGCAGCCTTTTGCATCGGCAGCGCCGCGCTGGCCAATTTCCTCCGC
ATGGAGGACTCCAAGACGACTTGGCACTATGCCTTGGCCATCCATATCGTGTCATGGGTGGCTCAGTTTGTTGGG
CACGGAGCCTTTGAGGGGCGTGCTCCTGCGCTGCTTGACAACTTGGCTCAAGCTCTCTTCCTGGCTCCCATGTTT
GTTTGGCTGGAACTTCTCTTCAAGCTGGGCTACCGCAGAGAGCTGCAGAGACGCGTGGACAAGAGGGTGCAGGTA
GAGATTGCCAAGTTTAGGGCTGCGTCCAAGGGCGGCAAGGCTGGGTCAAGGCCAAGTGGCGCTTCAAAGGCGCGG
CGTGGAGAGTAG
Transcript >OphauB2|2230
ATGTCGCTTGATCTGGAGCGGCATTTAACCTTTTATGGCGCCTATCACCACAACTCGGTCAACGTGGCCATTCAC
ATGGTGTGCGTGCCCCTGATTCTCGTCTCGGCCTTTTGCTTGGCTACCTACACAGGCACCTTGATTGAGGCGCCT
CTCTGGCTCACGGGGCCCTATCTCCATCTCAACCTGGGCACCATGGCAGCGGTTGGCTATGCGGCCCTCTACGTC
TTGCTCGAGCCCGTGGCAGGCTTCGTCCTGGCAGCCTTTTGCATCGGCAGCGCCGCGCTGGCCAATTTCCTCCGC
ATGGAGGACTCCAAGACGACTTGGCACTATGCCTTGGCCATCCATATCGTGTCATGGGTGGCTCAGTTTGTTGGG
CACGGAGCCTTTGAGGGGCGTGCTCCTGCGCTGCTTGACAACTTGGCTCAAGCTCTCTTCCTGGCTCCCATGTTT
GTTTGGCTGGAACTTCTCTTCAAGCTGGGCTACCGCAGAGAGCTGCAGAGACGCGTGGACAAGAGGGTGCAGGTA
GAGATTGCCAAGTTTAGGGCTGCGTCCAAGGGCGGCAAGGCTGGGTCAAGGCCAAGTGGCGCTTCAAAGGCGCGG
CGTGGAGAGTAG
Gene >OphauB2|2230
ATGTCGCTTGATCTGGAGCGGCATTTAACCTTTGTGCGTGGTGCCTGGTGGCGCTTGCCCAGCCTTGCTACAGCT
AACAGGTTGGCCCAGTATGGCGCCTATCACCACAACTCGGTCAACGTGGCCATTCACATGGTGTGCGTGCCCCTG
ATTCTCGTCTCGGCCTTTTGCTTGGTACGCTTTTGCTCCCAGTCTCGACCTCTTCTGCCGGGGCCTCATGCGGCC
AGTGGTGCGTGGCCTTTGCAAGGTGGACAGGCTCTCACGCAGCATCATGGATAGGCTACCTACACAGGCACCTTG
ATTGAGGCGCCTCTCTGGCTCACGGGGCCCTATCTCCATCTCAACCTGGGCACCATGGCAGCGGTTGGCTATGCG
GCCCTCTACGTCTTGCTCGAGCCCGTGGCAGGCTTCGTCCTGGCAGCCTTTTGCATCGGCAGCGCCGCGCTGGCC
AATTTCCTCCGCATGGAGGACTCCAAGACGACTTGGCACTATGCCTTGGCCATCCATATCGTGTCATGGGTGGCT
CAGTTTGTTGGGCACGGAGCCTTTGAGGGGCGTGCTCCTGCGCTGCTTGACAACTTGGCTCAAGCTCTCTTCCTG
GCTCCCATGTTTGTTTGGCTGGAACTTCTCTTCAAGCTGGGCTACCGCAGAGAGCTGCAGAGACGCGTGGACAAG
AGGGTGCAGGTAGAGATTGCCAAGTTTAGGGCTGCGTCCAAGGGCGGCAAGGCTGGGTCAAGGCCAAGTGGCGCT
TCAAAGGCGCGGCGTGGAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail