Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2223
Gene name
LocationContig_169:30512..31687
Strand+
Gene length (bp)1175
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01156 IU_nuc_hydro Inosine-uridine preferring nucleoside hydrolase 1.9E-12 27 273

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q27546|IUNH_CRIFA Inosine-uridine preferring nucleoside hydrolase OS=Crithidia fasciculata GN=IUNH PE=1 SV=3 25 244 2.0E-06

GO

GO Term Description Terminal node
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2223
MRLRHVCVLLVSQTLFTVANCPSKKKIIVDSDFFVDVDDAGALLLASTHPQVSLLGVNVNYPSSYSALAVSSLLG
YYGQGRVPVGLVRPYTNITYLDRYTYEHGEFASKVAYHWQQYAAVPWENVDSLHEPVSLYRQLLSNEQDGSVTIV
SLGFLDNLSRMLLSMPDSISAMSGRELVAAKVGELVVMGGQYPSGHEYNFAKYNATAAAHVIGAWPSCITFSGFE
IGQVVLSGGGLMLRGPEGDPVKAAYRWFNGQGNAHGSWDPLTMLYAIEGLGQIFEYGEGGYNYIYSNGTNEWQNA
TRNNAQHRFLKLTVSPREAGAVLDEYFLQGAMTASRD*
Coding >OphauB2|2223
ATGAGGCTGCGACATGTCTGCGTTCTTTTGGTCTCGCAGACCCTTTTTACTGTCGCGAATTGCCCAAGTAAGAAG
AAGATTATTGTCGATAGCGACTTCTTCGTTGATGTCGACGATGCGGGAGCTCTTCTCTTGGCCTCTACGCACCCC
CAAGTATCCCTCCTCGGTGTCAATGTAAATTACCCCTCATCCTATAGCGCGCTGGCTGTCTCTAGTCTGCTCGGG
TACTATGGTCAGGGCAGGGTGCCAGTCGGGCTGGTGCGACCATATACGAATATTACATATCTCGATCGATATACC
TATGAGCATGGCGAGTTTGCAAGCAAGGTTGCATACCACTGGCAGCAGTACGCCGCTGTACCGTGGGAAAATGTC
GACTCGTTGCATGAGCCGGTGAGCCTGTATCGTCAGCTCCTATCCAATGAGCAAGATGGTTCCGTGACGATTGTG
AGTCTTGGATTTTTAGACAATCTCTCTCGAATGCTCTTGTCCATGCCAGACTCCATTTCCGCCATGTCGGGGAGA
GAATTAGTTGCAGCCAAGGTTGGCGAGTTGGTCGTCATGGGTGGCCAGTATCCGTCTGGACATGAGTACAACTTT
GCCAAATACAATGCCACTGCAGCGGCTCATGTTATCGGAGCGTGGCCAAGTTGCATCACGTTTTCTGGCTTCGAG
ATTGGTCAAGTCGTTCTTTCCGGGGGTGGCCTCATGCTCAGAGGCCCAGAAGGTGATCCAGTAAAGGCAGCATAC
CGATGGTTCAATGGCCAAGGCAACGCTCATGGATCTTGGGATCCGCTGACTATGCTTTATGCGATTGAAGGGCTA
GGACAAATTTTTGAGTATGGAGAGGGTGGTTACAACTATATATATTCCAACGGCACAAATGAGTGGCAAAACGCA
ACGAGAAATAATGCTCAGCATCGCTTTCTCAAGCTCACAGTGTCGCCTCGCGAGGCTGGTGCTGTTCTTGATGAA
TACTTTTTGCAAGGTGCCATGACGGCAAGCAGAGACTGA
Transcript >OphauB2|2223
ATGAGGCTGCGACATGTCTGCGTTCTTTTGGTCTCGCAGACCCTTTTTACTGTCGCGAATTGCCCAAGTAAGAAG
AAGATTATTGTCGATAGCGACTTCTTCGTTGATGTCGACGATGCGGGAGCTCTTCTCTTGGCCTCTACGCACCCC
CAAGTATCCCTCCTCGGTGTCAATGTAAATTACCCCTCATCCTATAGCGCGCTGGCTGTCTCTAGTCTGCTCGGG
TACTATGGTCAGGGCAGGGTGCCAGTCGGGCTGGTGCGACCATATACGAATATTACATATCTCGATCGATATACC
TATGAGCATGGCGAGTTTGCAAGCAAGGTTGCATACCACTGGCAGCAGTACGCCGCTGTACCGTGGGAAAATGTC
GACTCGTTGCATGAGCCGGTGAGCCTGTATCGTCAGCTCCTATCCAATGAGCAAGATGGTTCCGTGACGATTGTG
AGTCTTGGATTTTTAGACAATCTCTCTCGAATGCTCTTGTCCATGCCAGACTCCATTTCCGCCATGTCGGGGAGA
GAATTAGTTGCAGCCAAGGTTGGCGAGTTGGTCGTCATGGGTGGCCAGTATCCGTCTGGACATGAGTACAACTTT
GCCAAATACAATGCCACTGCAGCGGCTCATGTTATCGGAGCGTGGCCAAGTTGCATCACGTTTTCTGGCTTCGAG
ATTGGTCAAGTCGTTCTTTCCGGGGGTGGCCTCATGCTCAGAGGCCCAGAAGGTGATCCAGTAAAGGCAGCATAC
CGATGGTTCAATGGCCAAGGCAACGCTCATGGATCTTGGGATCCGCTGACTATGCTTTATGCGATTGAAGGGCTA
GGACAAATTTTTGAGTATGGAGAGGGTGGTTACAACTATATATATTCCAACGGCACAAATGAGTGGCAAAACGCA
ACGAGAAATAATGCTCAGCATCGCTTTCTCAAGCTCACAGTGTCGCCTCGCGAGGCTGGTGCTGTTCTTGATGAA
TACTTTTTGCAAGGTGCCATGACGGCAAGCAGAGACTGA
Gene >OphauB2|2223
ATGAGGCTGCGACATGTCTGCGTTCTTTTGGTCTCGCAGACCCTTTTTACTGTCGCGAATTGCCCAAGTAAGAAG
AAGATTATTGTCGATAGCGACTTCTTCGTTGATGTCGAGTAGGTAATGCCGTCAAAATATATGCCGCATGATACT
CATATTTTATATAGCGATGCGGGAGCTCTTCTCTTGGCCTCTACGCACCCCCAAGTATCCCTCCTCGGTGTCAAT
GTAAATTACCCCTCATCCTATAGCGCGCTGGCTGTCTCTAGTCTGCTCGGGTACTATGGTCAGGGCAGGGTGCCA
GTCGGGCTGGTGCGACCATATACGAATATTACATATCTCGATCGATATACCTATGAGCATGGCGAGTTTGCAAGC
AAGGTTGCATACCACTGGCAGCAGTACGCCGCTGTACCGTGGGAAAATGTCGACTCGTTGCATGAGCCGGTGAGC
CTGTATCGTCAGCTCCTATCCAATGAGCAAGATGGTTCCGTGACGATTGTGAGTCTTGGATTTTTAGACAATGTA
AGTTTCTGGCTCTCGGTTAAAGCTATGGTGTTGGGCTTAGTTTGGGCCAGCTCTCTCGAATGCTCTTGTCCATGC
CAGACTCCATTTCCGCCATGTCGGGGAGAGAATTAGTTGCAGCCAAGGTTGGCGAGTTGGTCGTCATGGGTGGCC
AGTATCCGTCTGGACATGAGTACAACTTTGCCAAATACAATGCCACTGCAGCGGCTCATGTTATCGGAGCGTGGC
CAAGTTGCATCACGTTTTCTGGCTTCGAGATTGGTCAAGTCGTTCTTTCCGGGGGTGGCCTCATGCTCAGAGGCC
CAGAAGGTGATCCAGTAAAGGCAGCATACCGATGGTTCAAGTCTGACTCTCTCGTAATGTTTGTTTGATAGCGGC
GTGGCTAATAATCGTTTACTAGTGGCCAAGGCAACGCTCATGGATCTTGGGATCCGCTGACTATGCTTTATGCGA
TTGAAGGGCTAGGACAAATTTTTGAGTATGGAGAGGGTGGTTACAACTATATATATTCCAACGGCACAAATGAGT
GGCAAAACGCAACGAGAAATAATGCTCAGCATCGCTTTCTCAAGCTCACAGTGTCGCCTCGCGAGGCTGGTGCTG
TTCTTGATGAATACTTTTTGCAAGGTGCCATGACGGCAAGCAGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail