Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2207
Gene name
LocationContig_168:20692..24635
Strand-
Gene length (bp)3943
Transcript length (bp)3300
Coding sequence length (bp)3300
Protein length (aa) 1100

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B1B1|ALS1_ARTBC Agglutinin-like protein ARB_02240 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02240 PE=1 SV=1 507 934 7.0E-34
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 373 648 6.0E-09
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 378 647 5.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2207
MRCYWVLWGALTLSPVAAQVEDGLNQTAVQEIQSIQLAPTLAAQSTQAASLIQEAQSVHFGLTFSTGLTLSTGFT
SSFDLIQSASSHGTESIQLLSTQATLVQETQSTPTASAQSTSTQDTLATQFASTQTLPSASAQSTQLPMTQTTSP
ASQPQLTALSSIVKASGIRYFDSVACPVCCTATCTVCGPEQTVTVSTTVTQTVSVTVTESLTSLATQTQYTTQYE
TTTDFSTLTTSYPVTETYTKSCVPRQPDPTQQGGWPVRRHDYPEPPLYCETVTTTRWETTTTTLPVTSVVTSVAT
LTRVLTTVSIVPTTIQDNRTVTEIVTTPTTLWQTTTFTQATTLTTSYPVTVTSDRTVQTTSITTEYITTVSTFIS
SYPVVTSVTVPVTQTATITAPGQVTTLPTTVIVPTTATFTAPGPLTTITLPPLTTTLPGSTIVSTLTRELPPQTM
TVVQPVVTTMPGTTLTSTLPGTTVTMTLPRTIIEPGTTIREPGPVTTIMLPGTTRVLPASTITQPGTTSTVTMPG
PTSVLPGSTITVPGSVTTITLPGTTNILPGTTIREPGSVTTITLPASTQVLPGTTIREPGSVTTVVLPGETKILP
GTTVTEPGSITTITIGETKVMPGNTITEKGAVTTIVLPGETKTLPASTLVSTVTLSLPAETIYFSQPGAIHTTVL
PAQTSLLTTTVTIAPSTVVTPPRTTTSTLLTSITVCPVPTGASAPLSPQSDLTFGCKPGYVCNAPKPEGCNFWPE
PPSPDFLCNPANCIIAPPFINVTWKDNETSYYPPSEGYFNLNPEAFGLSYDIFVYDTYAEVVNGSLTTVTTGNWE
SQTSLSEYPRPTSASYQHKASGSQHYRRRLHDFAKRGDTYPASCYDTCNQVSLVGQSNGKNDALCRSGSRFMEAI
DVCQTCIKIRSARKKKTAQTAEIPSFAQYLNYCSGSQGQPARQSQSGPDRVVNVQPTLATTAQGATSSEGFHSLQ
RTSLGRAMTPDQDQQGTSVVEPQSSPRNFPQQQQSTQQVPAMVTRGSTATASTRQANVGSPTSPTVSIHTTISID
FGLSSPTLGPSPAQQTGASSAAGRGKARHHRQRLFHQWAVRPATRLRSK*
Coding >OphauB2|2207
ATGCGCTGCTATTGGGTGCTTTGGGGCGCCTTGACCCTATCCCCTGTTGCTGCACAGGTCGAAGATGGCCTGAAC
CAGACAGCAGTACAGGAGATTCAGTCGATTCAGCTTGCTCCTACTCTAGCAGCTCAATCGACGCAAGCGGCTTCA
TTGATCCAAGAGGCACAGTCTGTGCACTTTGGCTTAACATTTTCAACTGGTCTCACACTTTCAACTGGCTTCACT
TCAAGTTTTGATCTCATACAGTCTGCTTCGAGTCATGGGACAGAGTCAATCCAGCTGCTTTCCACGCAAGCCACT
CTGGTGCAAGAGACGCAGTCCACCCCAACTGCTTCGGCACAGTCCACTTCGACCCAAGATACACTGGCAACGCAG
TTTGCTTCCACACAGACTCTACCGTCAGCATCAGCTCAGTCGACCCAGCTACCTATGACACAGACGACGTCTCCA
GCATCGCAGCCACAGTTGACCGCCCTGAGCTCTATAGTCAAGGCGTCTGGCATACGCTACTTTGATAGTGTCGCG
TGTCCAGTGTGCTGCACTGCAACATGTACTGTTTGCGGACCCGAGCAAACCGTGACTGTTTCTACTACTGTTACG
CAAACCGTCTCCGTCACGGTGACTGAAAGTCTCACGTCACTCGCAACCCAGACACAGTATACAACACAATACGAA
ACAACGACCGACTTCTCGACCCTGACCACTTCGTACCCAGTCACGGAAACGTATACAAAGAGCTGTGTGCCTCGA
CAACCGGATCCCACTCAGCAAGGTGGCTGGCCAGTTCGCAGACACGACTATCCAGAACCGCCCCTCTACTGTGAG
ACAGTGACTACCACAAGATGGGAGACAACGACAACAACCCTTCCTGTAACGTCGGTGGTGACGTCTGTGGCTACC
CTGACACGGGTACTCACAACTGTGTCTATTGTGCCGACAACGATCCAGGACAACCGGACCGTGACGGAGATAGTC
ACAACGCCCACGACTCTCTGGCAGACGACTACCTTTACGCAGGCAACCACTTTGACGACTAGCTACCCTGTCACT
GTCACATCGGATCGCACCGTGCAAACCACGAGCATCACCACCGAGTACATCACGACTGTGTCAACCTTTATATCG
AGCTATCCTGTTGTGACTTCGGTGACAGTGCCCGTTACCCAGACAGCCACCATCACAGCTCCAGGACAAGTGACA
ACGCTTCCAACGACGGTTATTGTGCCTACCACAGCTACCTTTACTGCTCCAGGACCGCTGACTACGATTACACTT
CCTCCACTAACGACTACGCTACCTGGGTCGACAATTGTGTCTACACTGACAAGGGAGCTCCCGCCTCAGACCATG
ACAGTTGTGCAACCGGTTGTAACGACAATGCCTGGCACTACTTTGACGTCGACGTTGCCGGGCACAACCGTCACC
ATGACGCTGCCTCGCACGATCATAGAGCCAGGAACTACCATTAGAGAGCCTGGCCCTGTCACGACAATAATGCTT
CCAGGAACAACAAGGGTTCTTCCTGCATCCACAATCACCCAGCCAGGCACGACGAGTACCGTGACTATGCCAGGA
CCTACTTCAGTGCTCCCAGGCTCTACAATCACAGTGCCAGGATCAGTCACTACAATTACTCTTCCAGGGACAACT
AACATCTTGCCCGGTACTACTATTAGGGAGCCCGGATCAGTCACTACCATTACTCTTCCAGCATCTACCCAGGTT
TTGCCCGGCACAACCATCAGAGAGCCGGGATCAGTCACTACAGTTGTTTTACCAGGGGAAACAAAGATACTTCCT
GGAACGACAGTCACAGAGCCTGGTTCAATCACGACAATTACCATAGGAGAAACCAAGGTGATGCCGGGTAATACC
ATAACCGAAAAGGGCGCTGTCACGACAATTGTTCTTCCCGGCGAAACAAAGACTCTGCCTGCAAGCACCTTGGTC
TCGACGGTGACACTGTCACTCCCGGCAGAGACAATTTACTTTAGCCAGCCAGGGGCTATTCACACTACGGTTCTG
CCTGCCCAGACAAGCCTGCTGACAACAACGGTGACAATTGCTCCCAGCACAGTCGTGACTCCGCCCAGGACGACA
ACGTCGACGCTGTTGACTTCGATTACTGTCTGTCCGGTGCCAACGGGCGCCAGCGCTCCCTTGTCGCCTCAGTCT
GACCTTACATTTGGCTGCAAGCCGGGCTATGTGTGCAATGCTCCCAAGCCCGAAGGGTGCAACTTTTGGCCAGAG
CCTCCGTCGCCAGACTTCCTCTGCAACCCAGCCAACTGCATCATTGCTCCGCCTTTTATCAATGTGACGTGGAAG
GACAATGAGACGTCATACTACCCGCCCAGTGAAGGCTACTTCAACCTCAATCCCGAGGCGTTTGGATTGTCCTAC
GATATTTTTGTCTATGACACATATGCCGAGGTGGTGAATGGCTCGCTCACCACGGTGACGACGGGCAACTGGGAG
TCCCAGACAAGCCTCAGCGAATATCCTCGGCCAACTTCTGCATCGTATCAGCACAAGGCTTCTGGCAGCCAGCAT
TATCGCCGCCGACTGCATGACTTTGCCAAGAGAGGTGACACATATCCGGCTTCATGCTACGACACTTGCAACCAA
GTGAGCTTGGTTGGTCAAAGCAATGGCAAGAATGATGCCCTGTGCCGCAGTGGATCCCGCTTCATGGAAGCCATC
GACGTGTGCCAAACGTGCATCAAAATACGCAGCGCAAGAAAAAAGAAGACTGCACAGACTGCAGAGATCCCCTCA
TTTGCACAATATCTCAACTATTGCAGTGGGAGCCAGGGGCAGCCTGCAAGACAGTCCCAGTCGGGCCCAGACAGG
GTCGTCAATGTCCAGCCGACTCTAGCAACCACGGCCCAAGGCGCCACTAGCAGTGAGGGCTTCCACTCTCTCCAA
AGAACGTCGCTCGGCAGGGCAATGACGCCGGACCAGGACCAGCAGGGTACGAGCGTCGTTGAGCCGCAGTCGTCG
CCGCGTAACTTTCCACAGCAGCAACAAAGCACGCAGCAAGTACCAGCCATGGTTACTCGTGGTTCAACAGCCACG
GCTTCAACAAGACAGGCTAATGTTGGCTCTCCAACAAGTCCAACGGTATCTATTCACACCACCATCAGCATCGAC
TTTGGCTTGTCATCACCCACATTGGGTCCATCTCCAGCGCAGCAAACTGGAGCCAGTTCTGCCGCGGGTCGGGGC
AAGGCTCGACACCACAGACAAAGGCTCTTTCATCAATGGGCAGTCAGGCCGGCAACTCGCCTCCGCAGCAAGTGA
Transcript >OphauB2|2207
ATGCGCTGCTATTGGGTGCTTTGGGGCGCCTTGACCCTATCCCCTGTTGCTGCACAGGTCGAAGATGGCCTGAAC
CAGACAGCAGTACAGGAGATTCAGTCGATTCAGCTTGCTCCTACTCTAGCAGCTCAATCGACGCAAGCGGCTTCA
TTGATCCAAGAGGCACAGTCTGTGCACTTTGGCTTAACATTTTCAACTGGTCTCACACTTTCAACTGGCTTCACT
TCAAGTTTTGATCTCATACAGTCTGCTTCGAGTCATGGGACAGAGTCAATCCAGCTGCTTTCCACGCAAGCCACT
CTGGTGCAAGAGACGCAGTCCACCCCAACTGCTTCGGCACAGTCCACTTCGACCCAAGATACACTGGCAACGCAG
TTTGCTTCCACACAGACTCTACCGTCAGCATCAGCTCAGTCGACCCAGCTACCTATGACACAGACGACGTCTCCA
GCATCGCAGCCACAGTTGACCGCCCTGAGCTCTATAGTCAAGGCGTCTGGCATACGCTACTTTGATAGTGTCGCG
TGTCCAGTGTGCTGCACTGCAACATGTACTGTTTGCGGACCCGAGCAAACCGTGACTGTTTCTACTACTGTTACG
CAAACCGTCTCCGTCACGGTGACTGAAAGTCTCACGTCACTCGCAACCCAGACACAGTATACAACACAATACGAA
ACAACGACCGACTTCTCGACCCTGACCACTTCGTACCCAGTCACGGAAACGTATACAAAGAGCTGTGTGCCTCGA
CAACCGGATCCCACTCAGCAAGGTGGCTGGCCAGTTCGCAGACACGACTATCCAGAACCGCCCCTCTACTGTGAG
ACAGTGACTACCACAAGATGGGAGACAACGACAACAACCCTTCCTGTAACGTCGGTGGTGACGTCTGTGGCTACC
CTGACACGGGTACTCACAACTGTGTCTATTGTGCCGACAACGATCCAGGACAACCGGACCGTGACGGAGATAGTC
ACAACGCCCACGACTCTCTGGCAGACGACTACCTTTACGCAGGCAACCACTTTGACGACTAGCTACCCTGTCACT
GTCACATCGGATCGCACCGTGCAAACCACGAGCATCACCACCGAGTACATCACGACTGTGTCAACCTTTATATCG
AGCTATCCTGTTGTGACTTCGGTGACAGTGCCCGTTACCCAGACAGCCACCATCACAGCTCCAGGACAAGTGACA
ACGCTTCCAACGACGGTTATTGTGCCTACCACAGCTACCTTTACTGCTCCAGGACCGCTGACTACGATTACACTT
CCTCCACTAACGACTACGCTACCTGGGTCGACAATTGTGTCTACACTGACAAGGGAGCTCCCGCCTCAGACCATG
ACAGTTGTGCAACCGGTTGTAACGACAATGCCTGGCACTACTTTGACGTCGACGTTGCCGGGCACAACCGTCACC
ATGACGCTGCCTCGCACGATCATAGAGCCAGGAACTACCATTAGAGAGCCTGGCCCTGTCACGACAATAATGCTT
CCAGGAACAACAAGGGTTCTTCCTGCATCCACAATCACCCAGCCAGGCACGACGAGTACCGTGACTATGCCAGGA
CCTACTTCAGTGCTCCCAGGCTCTACAATCACAGTGCCAGGATCAGTCACTACAATTACTCTTCCAGGGACAACT
AACATCTTGCCCGGTACTACTATTAGGGAGCCCGGATCAGTCACTACCATTACTCTTCCAGCATCTACCCAGGTT
TTGCCCGGCACAACCATCAGAGAGCCGGGATCAGTCACTACAGTTGTTTTACCAGGGGAAACAAAGATACTTCCT
GGAACGACAGTCACAGAGCCTGGTTCAATCACGACAATTACCATAGGAGAAACCAAGGTGATGCCGGGTAATACC
ATAACCGAAAAGGGCGCTGTCACGACAATTGTTCTTCCCGGCGAAACAAAGACTCTGCCTGCAAGCACCTTGGTC
TCGACGGTGACACTGTCACTCCCGGCAGAGACAATTTACTTTAGCCAGCCAGGGGCTATTCACACTACGGTTCTG
CCTGCCCAGACAAGCCTGCTGACAACAACGGTGACAATTGCTCCCAGCACAGTCGTGACTCCGCCCAGGACGACA
ACGTCGACGCTGTTGACTTCGATTACTGTCTGTCCGGTGCCAACGGGCGCCAGCGCTCCCTTGTCGCCTCAGTCT
GACCTTACATTTGGCTGCAAGCCGGGCTATGTGTGCAATGCTCCCAAGCCCGAAGGGTGCAACTTTTGGCCAGAG
CCTCCGTCGCCAGACTTCCTCTGCAACCCAGCCAACTGCATCATTGCTCCGCCTTTTATCAATGTGACGTGGAAG
GACAATGAGACGTCATACTACCCGCCCAGTGAAGGCTACTTCAACCTCAATCCCGAGGCGTTTGGATTGTCCTAC
GATATTTTTGTCTATGACACATATGCCGAGGTGGTGAATGGCTCGCTCACCACGGTGACGACGGGCAACTGGGAG
TCCCAGACAAGCCTCAGCGAATATCCTCGGCCAACTTCTGCATCGTATCAGCACAAGGCTTCTGGCAGCCAGCAT
TATCGCCGCCGACTGCATGACTTTGCCAAGAGAGGTGACACATATCCGGCTTCATGCTACGACACTTGCAACCAA
GTGAGCTTGGTTGGTCAAAGCAATGGCAAGAATGATGCCCTGTGCCGCAGTGGATCCCGCTTCATGGAAGCCATC
GACGTGTGCCAAACGTGCATCAAAATACGCAGCGCAAGAAAAAAGAAGACTGCACAGACTGCAGAGATCCCCTCA
TTTGCACAATATCTCAACTATTGCAGTGGGAGCCAGGGGCAGCCTGCAAGACAGTCCCAGTCGGGCCCAGACAGG
GTCGTCAATGTCCAGCCGACTCTAGCAACCACGGCCCAAGGCGCCACTAGCAGTGAGGGCTTCCACTCTCTCCAA
AGAACGTCGCTCGGCAGGGCAATGACGCCGGACCAGGACCAGCAGGGTACGAGCGTCGTTGAGCCGCAGTCGTCG
CCGCGTAACTTTCCACAGCAGCAACAAAGCACGCAGCAAGTACCAGCCATGGTTACTCGTGGTTCAACAGCCACG
GCTTCAACAAGACAGGCTAATGTTGGCTCTCCAACAAGTCCAACGGTATCTATTCACACCACCATCAGCATCGAC
TTTGGCTTGTCATCACCCACATTGGGTCCATCTCCAGCGCAGCAAACTGGAGCCAGTTCTGCCGCGGGTCGGGGC
AAGGCTCGACACCACAGACAAAGGCTCTTTCATCAATGGGCAGTCAGGCCGGCAACTCGCCTCCGCAGCAAGTGA
Gene >OphauB2|2207
ATGCGCTGCTATTGGGTGCTTTGGGGCGCCTTGACCCTATCCCCTGTTGCTGCACAGGTCGAAGATGGCCTGAAC
CAGACAGCAGTACAGGAGATTCAGTCGATTCAGCTTGCTCCTACTCTAGCAGCTCAATCGACGCAAGCGGCTTCA
TTGATCCAAGAGGCACAGTCTGTGCACTTTGGCTTAACATTTTCAACTGGTCTCACACTTTCAACTGGCTTCACT
TCAAGTTTTGATCTCATACAGTCTGCTTCGAGTCATGGGACAGAGTCAATCCAGCTGCTTTCCACGCAAGCCACT
CTGGTGCAAGAGACGCAGTCCACCCCAACTGCTTCGGCACAGTCCACTTCGACCCAAGATACACTGGCAACGCAG
TTTGCTTCCACACAGACTCTACCGTCAGCATCAGCTCAGTCGACCCAGCTACCTATGACACAGACGACGTCTCCA
GCATCGCAGCCACAGTTGACCGCCCTGAGCTCTATAGTCAAGGCGTCTGGCATACGCTACTTTGATAGTGTCGCG
TGTCCAGTGTGCTGCACTGCAACATGTACTGTTTGCGGACCCGAGTTAGTGCATGTCCTAGCACTGAAATATTGC
ACCTTGAACTGACGATGGATGATTTAGGCAAACCGTGACTGTTTCTGTAAATTGAATCTATTGTTCGCTGATGCT
ATTGTAGTAAATCCTCTAACATTGGTCTCATATAGACTACTGTTACGCAAACCGTCTCCGTCACGGTGACTGAAA
GTCTCACGTCACTCGCAACCCAGACACAGTATACAACACAATACGAAACAACGACCGACTTCTCGACCCTGACCA
CTGTATGTTGACACATGTTTACCAAAAACCTGCAGTCAAGCTGATATAGTTCTAAGTCGTACCCAGTCACGGAAA
CGTATACAAAGAGGTAGGTTGAAAAACAAACCACAAGTGTAGCTCGCACGCAGAACTGGAGGGCTAAGAGGAGAT
TTCAGCTGTGTGCCTCGACAACCGGATCCCACTCAGCAAGGTGAGCGATGCTGATGCTGTCCTGGTAAACAAGCC
AGGAATAACTGACTGACGAGTATACAAGGTGGCTGGCCAGTTCGCAGACACGACTATCCAGAACCGCCCCTCTAC
TGTGAGACAGTGACTACCACAAGATGGGAGACAACGACAACAACCCTTCCTGTAACGTCGGTGGTGACGTCTGTG
GCTACCCTGACACGGGTACTCACAACTGTGTCTATTGTGCCGACAACGATCCAGGACAACCGGACCGTGACGGAG
ATAGTCACAACGCCCACGACTCTCTGGCAGACGACTACCTTTACGCAGGCAACCACTTTGACGACTAGCTACCCT
GTCACTGTCACATCGGATCGCACCGTGCAAACCACGAGCATCACCACCGAGTACATCACGACTGTGTCAACCTTT
ATATCGAGCTATCCTGTTGTGACTTCGGTGACAGTGCCCGTTACCCAGACAGCCACCATCACAGCTCCAGGACAA
GTGACAACGCTTCCAACGACGGTTATTGTGCCTACCACAGCTACCTTTACTGCTCCAGGTCAGCTAACGACGGTG
ACTCTGCCACCTAAAACAATCACGCTATCTGGCTCAACCGTCGTGTCTTCCATTACTACGTCGCTTCCGCCCCAA
ACCATCACCGTCATTAAGGAAGGGACGACTTTGATCACGACGGTTACTGGTACAGGACCGCTGACTACGATTACA
CTTCCTCCACTAACGACTACGCTACCTGGGTCGACAATTGTGTCTACACTGACAAGGGAGCTCCCGCCTCAGACC
ATGACAGTTGTGCAACCGGGTACGACGATAACAACTAGCCTTCCGGGAACTACATTGTTGACTACCTTGCCCGGT
GAGACTATTACGGTAACTCAGAGAGGCACTACACTTACCTCGACTTTGCCTGGGACCACAGTTGTAACGACAATG
CCTGGCACTACTTTGACGTCGACGTTGCCGGGCACAACCGTCACCATGACGCTGCCTCGCACGATCATAGAGCCA
GGAACTACCATTAGAGAGCCTGGCCCTGTCACGACAATAATGCTTCCAGGAACAACAAGGGTTCTTCCTGCATCC
ACAATCACCCAGCCAGGCACGACGAGTACCGTGACTATGCCAGGACCTACTTCAGTGCTCCCAGGCTCTACAATC
ACAGTGCCAGGATCAGTCACTACAATTACTCTTCCAGGGACAACTAACATCTTGCCCGGTACTACTATTAGGGAG
CCCGGATCAGTCACTACCATTACTCTTCCAGCATCTACCCAGGTTTTGCCCGGCACAACCATCAGAGAGCCGGGA
TCAGTCACTACAGTTGTTTTACCAGGGGAAACAAAGATACTTCCTGGAACGACAGTCACAGAGCCTGGTTCAATC
ACGACAATTACCATAGGAGAAACCAAGGTGATGCCGGGTAATACCATAACCGAAAAGGGCGCTGTCACGACAATT
GTTCTTCCCGGCGAAACAAAGACTCTGCCTGCAAGCACCTTGGTCTCGACGGTGACACTGTCACTCCCGGCAGAG
ACAATTTACTTTAGCCAGCCAGGGGCTATTCACACTACGGTTCTGCCTGCCCAGACAAGCCTGCTGACAACAACG
GTGACAATTGCTCCCAGCACAGTCGTGACTCCGCCCAGGACGACAACGTCGACGCTGTTGACTTCGATTACTGTC
TGTCCGGTGCCAACGGGCGCCAGCGCTCCCTTGTCGCCTCAGTCTGACCTTACATTTGGCTGCAAGCCGGGCTAT
GTGTGCAATGCTCCCAAGCCCGAAGGGTGCAACTTTTGGCCAGAGCCTCCGTCGCCAGACTTCCTCTGCAACCCA
GCCAACTGCATCATTGCTCCGCCTTTTATCAATGTGACGTGGAAGGACAATGAGACGTCATACTACCCGCCCAGT
GAAGGCTACTTCAACCTCAATCCCGAGGCGTTTGGATTGTCCTACGATATTTTTGTCTATGACACATATGCCGAG
GTGGTGAATGGCTCGCTCACCACGGTGACGACGGGCAACTGGGAGTCCCAGACAAGCCTCAGCGAATATCCTCGG
CCAACTTCTGCATCGTATCAGCACAAGGCTTCTGGCAGCCAGCATTATCGCCGCCGACTGCATGACTTTGCCAAG
AGAGGTGACACATATCCGGCTTCATGCTACGACACTTGCAACCAAGTGAGCTTGGTTGGTCAAAGCAATGGCAAG
AATGATGCCCTGTGCCGCAGTGGATCCCGCTTCATGGAAGCCATCGACGTGTGCCAAACGTGCATCAAAATACGC
AGCGCAAGAAAAAAGAAGACTGCACAGACTGCAGAGATCCCCTCATTTGCACAATATCTCAACTATTGCAGTGGG
AGCCAGGGGCAGCCTGCAAGACAGTCCCAGTCGGGCCCAGACAGGGTCGTCAATGTCCAGCCGACTCTAGCAACC
ACGGCCCAAGGCGCCACTAGCAGTGAGGGCTTCCACTCTCTCCAAAGAACGTCGCTCGGCAGGGCAATGACGCCG
GACCAGGACCAGCAGGGTACGAGCGTCGTTGAGCCGCAGTCGTCGCCGCGTAACTTTCCACAGCAGCAACAAAGC
ACGCAGCAAGTACCAGCCATGGTTACTCGTGGTTCAACAGCCACGGCTTCAACAAGACAGGCTAATGTTGGCTCT
CCAACAAGTCCAACGGTATCTATTCACACCACCATCAGCATCGACTTTGGCTTGTCATCACCCACATTGGGTCCA
TCTCCAGCGCAGCAAACTGGAGCCAGTTCTGCCGCGGGTCGGGGTACGGCGAGCTCACTGGTGTCTATACACACC
ACGCTGAGTGTTGACCTTGGAATACCGTTGTCTGGATCGAGGCAAGGCTCGACACCACAGACAAAGGCTCTTTCA
TCAATGGGCAGTCAGGCCGGCAACTCGCCTCCGCAGCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail