Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2197
Gene name
LocationContig_167:31512..33707
Strand-
Gene length (bp)2195
Transcript length (bp)2013
Coding sequence length (bp)2013
Protein length (aa) 671

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain 3.6E-36 322 473
PF00149 Metallophos Calcineurin-like phosphoesterase 5.8E-06 30 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A9BJC1|MGGB_PETMO Mannosylglucosyl-3-phosphoglycerate phosphatase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mggB PE=1 SV=1 23 518 3.0E-33
sp|Q9XZ43|5NTD_LUTLO Protein 5NUC OS=Lutzomyia longipalpis GN=5NUC PE=1 SV=1 24 472 5.0E-32
sp|O34313|NTPES_BACSU Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) GN=yfkN PE=1 SV=1 28 491 5.0E-30
sp|Q05927|5NTD_BOVIN 5'-nucleotidase OS=Bos taurus GN=NT5E PE=1 SV=2 25 475 9.0E-29
sp|F8S0Z7|V5NTD_CROAD Snake venom 5'-nucleotidase OS=Crotalus adamanteus PE=1 SV=2 16 475 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A9BJC1|MGGB_PETMO Mannosylglucosyl-3-phosphoglycerate phosphatase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mggB PE=1 SV=1 23 518 3.0E-33
sp|Q9XZ43|5NTD_LUTLO Protein 5NUC OS=Lutzomyia longipalpis GN=5NUC PE=1 SV=1 24 472 5.0E-32
sp|O34313|NTPES_BACSU Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) GN=yfkN PE=1 SV=1 28 491 5.0E-30
sp|Q05927|5NTD_BOVIN 5'-nucleotidase OS=Bos taurus GN=NT5E PE=1 SV=2 25 475 9.0E-29
sp|F8S0Z7|V5NTD_CROAD Snake venom 5'-nucleotidase OS=Crotalus adamanteus PE=1 SV=2 16 475 2.0E-26
sp|Q61503|5NTD_MOUSE 5'-nucleotidase OS=Mus musculus GN=Nt5e PE=1 SV=2 28 490 7.0E-26
sp|P21589|5NTD_HUMAN 5'-nucleotidase OS=Homo sapiens GN=NT5E PE=1 SV=1 14 475 1.0E-25
sp|B6EWW8|V5NTD_GLOBR Snake venom 5'-nucleotidase OS=Gloydius brevicaudus PE=2 SV=1 16 475 1.0E-25
sp|P29240|5NTD_DIPOM 5'-nucleotidase OS=Diplobatis ommata PE=2 SV=1 3 475 4.0E-25
sp|P22848|5NTD_VIBPA 5'-nucleotidase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=nutA PE=3 SV=2 49 475 3.0E-24
sp|Q9KQ30|5NTD_VIBCH 5'-nucleotidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nutA PE=3 SV=1 49 475 7.0E-24
sp|P06196|USHA_SALTY Silent protein UshA(0) OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ushA PE=3 SV=2 28 475 8.0E-24
sp|P07024|USHA_ECOLI Protein UshA OS=Escherichia coli (strain K12) GN=ushA PE=1 SV=2 49 475 1.0E-23
sp|Q8DFG4|5NTD_VIBVU 5'-nucleotidase OS=Vibrio vulnificus (strain CMCP6) GN=nutA PE=3 SV=2 49 475 2.0E-22
sp|Q9RN37|USHA_SALPU Protein UshA OS=Salmonella pullorum GN=ushA PE=3 SV=1 28 475 1.0E-20
sp|Q56878|USHA_YERE8 Protein UshA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ushA PE=3 SV=3 99 475 4.0E-20
sp|B3A0N5|APY_TABYA Apyrase OS=Tabanus yao PE=1 SV=1 41 472 2.0E-19
sp|P21588|5NTD_RAT 5'-nucleotidase OS=Rattus norvegicus GN=Nt5e PE=1 SV=1 28 490 2.0E-19
sp|P54602|YHCR_BACSU Endonuclease YhcR OS=Bacillus subtilis (strain 168) GN=yhcR PE=1 SV=1 8 465 1.0E-18
sp|P52307|5NTD_RHIMP Protein 5NUC (Fragment) OS=Rhipicephalus microplus PE=1 SV=2 30 480 8.0E-18
sp|O34313|NTPES_BACSU Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) GN=yfkN PE=1 SV=1 27 524 2.0E-17
sp|E0D877|APY_AEDAL Apyrase OS=Aedes albopictus PE=1 SV=1 27 514 2.0E-14
sp|P44569|5NTD_HAEIN NAD 5'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0206 PE=1 SV=1 73 242 4.0E-11
sp|P50635|APY_AEDAE Apyrase OS=Aedes aegypti GN=APY PE=1 SV=2 27 475 2.0E-10
sp|P08331|CPDB_ECOLI 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) GN=cpdB PE=1 SV=2 27 263 6.0E-09
sp|O83142|5NTD_TREPA Probable 5'-nucleotidase OS=Treponema pallidum (strain Nichols) GN=TP_0104 PE=3 SV=1 23 242 9.0E-09
sp|P44764|CPDB_HAEIN 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cpdB PE=3 SV=1 91 241 1.0E-08
sp|P26265|CPDB_SALTY 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cpdB PE=3 SV=2 99 255 1.0E-07
sp|P53052|CPDB_YEREN 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Yersinia enterocolitica GN=cpdB PE=3 SV=1 94 253 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009166 nucleotide catabolic process Yes
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0046700 heterocycle catabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0006793 phosphorus metabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901292 nucleoside phosphate catabolic process No
GO:0009117 nucleotide metabolic process No
GO:1901575 organic substance catabolic process No
GO:0046434 organophosphate catabolic process No
GO:0009056 catabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0003824 catalytic activity No
GO:0044248 cellular catabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2197
MEAEKKGASSKAQATCWSGRDGSGPPHVRMLHYNDVYHVDQASAEPVGGLARFMTLVDEYRDGQQFQGQPELLTL
FSGDAFNPSLESTVTKGRHMVHVLNAIKTDCACAGNHDFDFGVEQFRHLTEQCNFPWLLANVLDPALGKDVPMGN
AKRTHMMTMGSGIKVGLIGLVEREWLATLNSLPPNVIYKSATATAQELVPQLRQQGADIVICLSHMREPNDNKLA
EQTDGLLDLILGGHDHYYNYSFIKGTHVLRSGSDFKQLSYIEARKRQAKDSNSNARQLWDFDIWRRDVTSEVPEK
EHTAQLVAKLVAKLESSLSRAVGWTATPLDARFSTVRLSESNMGNFVCDVMRSFHGADCALMASGTIRGDQIYPP
GVVRIKDITNCFPFEDGVILLRVKGQAIRDALENGVSTYPALEGRFPQVSNISFEFNPDKAKGSRITSLTIGGQE
CEPDKSYTLATRGYMGRGKDGYESLLVESKGGKAQEIVDEENGILLSAMLRQYFMSLRTIGQWKKLPRNWKSVTE
DTKESTSATEQQPRDTNSRGNYGSLGLHKDTSNKDDQGDESGTGEAAWRRFLRQRLGLDKQPPSEDDDDDHFDPD
KDTGQGDAAGDAETGMDLEILLLRKFWARWVLKAGVKSAVCDALHKGEYAVDWTRVIAPTLEGRIKMTRV*
Coding >OphauB2|2197
ATGGAGGCAGAAAAGAAAGGAGCGTCGTCCAAGGCACAGGCGACTTGCTGGTCAGGCCGAGATGGGTCCGGACCA
CCCCATGTGCGAATGCTGCACTACAATGATGTATACCACGTGGACCAGGCGAGCGCGGAGCCTGTGGGAGGCCTG
GCGCGCTTCATGACCCTCGTCGACGAGTATCGTGATGGGCAGCAGTTCCAGGGACAGCCCGAGCTGCTGACGCTC
TTTTCCGGCGATGCCTTCAACCCCAGCCTGGAGAGCACCGTTACCAAGGGCCGGCACATGGTGCATGTGCTCAAT
GCCATCAAGACGGACTGTGCTTGCGCTGGGAACCATGACTTTGACTTTGGCGTCGAGCAGTTCCGCCACTTGACG
GAGCAGTGCAACTTTCCCTGGCTGCTGGCAAACGTGCTGGATCCAGCTCTGGGCAAGGACGTGCCCATGGGGAAT
GCCAAGCGCACTCACATGATGACAATGGGAAGCGGCATCAAGGTTGGCCTCATTGGCCTGGTGGAGCGGGAGTGG
CTGGCCACTCTCAACAGCCTGCCGCCCAACGTCATTTACAAATCCGCCACGGCAACGGCCCAGGAGCTGGTGCCC
CAGCTGCGGCAGCAGGGCGCAGATATTGTCATTTGTCTAAGCCATATGCGTGAGCCAAACGACAACAAGCTGGCA
GAGCAGACTGACGGGCTCTTGGACCTGATTCTGGGCGGCCATGACCACTACTACAACTACAGCTTCATCAAGGGC
ACCCATGTTCTACGGTCAGGGAGCGACTTCAAGCAGCTAAGCTACATTGAAGCCCGCAAGAGACAGGCAAAAGAC
AGCAACTCGAATGCGCGCCAGCTCTGGGACTTTGACATTTGGCGCCGCGACGTCACCTCCGAGGTGCCTGAAAAG
GAGCACACGGCCCAGCTCGTGGCCAAACTCGTGGCCAAACTGGAAAGCTCACTCTCGCGCGCGGTGGGCTGGACG
GCGACGCCATTGGATGCACGCTTCAGCACAGTACGTCTTAGCGAGTCCAACATGGGCAACTTTGTCTGTGACGTG
ATGCGAAGCTTTCATGGCGCCGACTGTGCCTTGATGGCCTCTGGCACCATTCGTGGAGACCAGATTTACCCGCCA
GGCGTTGTTCGCATCAAGGATATTACCAATTGCTTTCCCTTTGAGGATGGAGTCATTCTCCTCCGTGTCAAGGGC
CAGGCCATCCGCGACGCACTGGAAAACGGCGTCTCGACCTATCCAGCCTTGGAAGGTCGCTTTCCTCAGGTGTCG
AATATATCCTTTGAATTCAACCCTGACAAGGCCAAGGGGAGTAGAATCACCTCTCTCACTATTGGTGGACAAGAG
TGCGAGCCAGACAAGTCGTATACTCTAGCCACTAGAGGATACATGGGACGAGGCAAAGATGGATACGAGAGCTTG
CTGGTAGAATCCAAGGGCGGCAAAGCCCAGGAAATAGTGGATGAGGAGAATGGCATCCTGCTATCAGCAATGCTG
CGCCAGTACTTTATGAGCCTGCGGACCATTGGGCAGTGGAAGAAGCTCCCCAGGAATTGGAAGAGCGTGACTGAG
GATACCAAGGAATCCACCTCGGCAACAGAGCAGCAGCCTCGCGACACCAATAGCCGAGGCAACTACGGCTCCCTG
GGCTTGCACAAGGATACAAGTAACAAGGACGACCAAGGAGACGAGAGCGGGACTGGCGAGGCCGCATGGCGACGT
TTTCTCAGACAGCGCCTGGGGCTCGACAAGCAGCCTCCAAGCGAGGATGACGACGACGACCACTTTGACCCAGAC
AAGGACACGGGCCAGGGCGACGCAGCGGGAGACGCCGAGACGGGCATGGACCTGGAGATTTTGTTGCTAAGGAAA
TTTTGGGCGCGCTGGGTGCTCAAGGCGGGTGTCAAGTCGGCCGTTTGTGACGCGCTTCACAAGGGAGAGTATGCC
GTTGACTGGACGCGTGTGATTGCGCCGACGCTAGAGGGCAGAATCAAAATGACTCGAGTGTAG
Transcript >OphauB2|2197
ATGGAGGCAGAAAAGAAAGGAGCGTCGTCCAAGGCACAGGCGACTTGCTGGTCAGGCCGAGATGGGTCCGGACCA
CCCCATGTGCGAATGCTGCACTACAATGATGTATACCACGTGGACCAGGCGAGCGCGGAGCCTGTGGGAGGCCTG
GCGCGCTTCATGACCCTCGTCGACGAGTATCGTGATGGGCAGCAGTTCCAGGGACAGCCCGAGCTGCTGACGCTC
TTTTCCGGCGATGCCTTCAACCCCAGCCTGGAGAGCACCGTTACCAAGGGCCGGCACATGGTGCATGTGCTCAAT
GCCATCAAGACGGACTGTGCTTGCGCTGGGAACCATGACTTTGACTTTGGCGTCGAGCAGTTCCGCCACTTGACG
GAGCAGTGCAACTTTCCCTGGCTGCTGGCAAACGTGCTGGATCCAGCTCTGGGCAAGGACGTGCCCATGGGGAAT
GCCAAGCGCACTCACATGATGACAATGGGAAGCGGCATCAAGGTTGGCCTCATTGGCCTGGTGGAGCGGGAGTGG
CTGGCCACTCTCAACAGCCTGCCGCCCAACGTCATTTACAAATCCGCCACGGCAACGGCCCAGGAGCTGGTGCCC
CAGCTGCGGCAGCAGGGCGCAGATATTGTCATTTGTCTAAGCCATATGCGTGAGCCAAACGACAACAAGCTGGCA
GAGCAGACTGACGGGCTCTTGGACCTGATTCTGGGCGGCCATGACCACTACTACAACTACAGCTTCATCAAGGGC
ACCCATGTTCTACGGTCAGGGAGCGACTTCAAGCAGCTAAGCTACATTGAAGCCCGCAAGAGACAGGCAAAAGAC
AGCAACTCGAATGCGCGCCAGCTCTGGGACTTTGACATTTGGCGCCGCGACGTCACCTCCGAGGTGCCTGAAAAG
GAGCACACGGCCCAGCTCGTGGCCAAACTCGTGGCCAAACTGGAAAGCTCACTCTCGCGCGCGGTGGGCTGGACG
GCGACGCCATTGGATGCACGCTTCAGCACAGTACGTCTTAGCGAGTCCAACATGGGCAACTTTGTCTGTGACGTG
ATGCGAAGCTTTCATGGCGCCGACTGTGCCTTGATGGCCTCTGGCACCATTCGTGGAGACCAGATTTACCCGCCA
GGCGTTGTTCGCATCAAGGATATTACCAATTGCTTTCCCTTTGAGGATGGAGTCATTCTCCTCCGTGTCAAGGGC
CAGGCCATCCGCGACGCACTGGAAAACGGCGTCTCGACCTATCCAGCCTTGGAAGGTCGCTTTCCTCAGGTGTCG
AATATATCCTTTGAATTCAACCCTGACAAGGCCAAGGGGAGTAGAATCACCTCTCTCACTATTGGTGGACAAGAG
TGCGAGCCAGACAAGTCGTATACTCTAGCCACTAGAGGATACATGGGACGAGGCAAAGATGGATACGAGAGCTTG
CTGGTAGAATCCAAGGGCGGCAAAGCCCAGGAAATAGTGGATGAGGAGAATGGCATCCTGCTATCAGCAATGCTG
CGCCAGTACTTTATGAGCCTGCGGACCATTGGGCAGTGGAAGAAGCTCCCCAGGAATTGGAAGAGCGTGACTGAG
GATACCAAGGAATCCACCTCGGCAACAGAGCAGCAGCCTCGCGACACCAATAGCCGAGGCAACTACGGCTCCCTG
GGCTTGCACAAGGATACAAGTAACAAGGACGACCAAGGAGACGAGAGCGGGACTGGCGAGGCCGCATGGCGACGT
TTTCTCAGACAGCGCCTGGGGCTCGACAAGCAGCCTCCAAGCGAGGATGACGACGACGACCACTTTGACCCAGAC
AAGGACACGGGCCAGGGCGACGCAGCGGGAGACGCCGAGACGGGCATGGACCTGGAGATTTTGTTGCTAAGGAAA
TTTTGGGCGCGCTGGGTGCTCAAGGCGGGTGTCAAGTCGGCCGTTTGTGACGCGCTTCACAAGGGAGAGTATGCC
GTTGACTGGACGCGTGTGATTGCGCCGACGCTAGAGGGCAGAATCAAAATGACTCGAGTGTAG
Gene >OphauB2|2197
ATGGAGGCAGAAAAGAAAGGAGCGTCGTCCAAGGCACAGGCGACTTGCTGGTCAGGCCGAGATGGGTCCGGACCA
CCCCATGTGCGAATGCTGCACTACAATGATGTATACCACGTGGACCAGGCGAGCGCGGAGCCTGTGGGAGGCCTG
GCGCGCTTCATGACCCTCGTCGACGAGTATCGTGATGGGCAGCAGTTCCAGGGACAGCCCGAGCTGCTGACGCTC
TTTTCCGGCGATGCCTTCAACCCCAGCCTGGAGAGCACCGTTACCAAGGGTCAGTCTCGGACGCGAGACACGTGA
CATGAGGCAAGCAGGCTAACACAGGCGCTGTTGCGTATCCAAGGCCGGCACATGGTGCATGTGCTCAATGCCATC
AAGACGGACTGTGCTTGCGCTGGGGTGAGTCTGGGCATGCAAGCTGCCACAAGTCGGCCACTGAGCAATGCCCGC
CGCAGAACCATGACTTTGACTTTGGCGTCGAGCAGTTCCGCCACTTGACGGAGCAGTGCAACTTTCCCTGGCTGC
TGGCAAACGTGCTGGATCCAGCTCTGGGCAAGGACGTGCCCATGGGGAATGCCAAGCGCACTCACATGATGACAA
TGGGAAGCGGCATCAAGGTTGGCCTCATTGGCCTGGTGGAGCGGGAGTGGCTGGCCACTCTCAACAGCCTGCCGC
CCAACGTCATTTACAAATCCGCCACGGCAACGGCCCAGGAGCTGGTGCCCCAGCTGCGGCAGCAGGGCGCAGATA
TTGTCATTTGTCTAAGCCATATGCGTGAGCCAAACGACAACAAGCTGGCAGAGCAGACTGACGGGCTCTTGGACC
TGATTCTGGGCGGCCATGACCACTACTACAACTACAGCTTCATCAAGGGCACCCATGTTCTACGGTCAGGGAGCG
ACTTCAAGCAGCTAAGCTACATTGAAGCCCGCAAGAGACAGGCAAAAGACAGCAACTCGAATGCGCGCCAGCTCT
GGGACTTTGACATTTGGCGCCGCGACGTCACCTCCGAGGTGCCTGAAAAGGAGCACACGGCCCAGCTCGTGGCCA
AACTCGTGGCCAAACTGGAAAGCTCACTCTCGCGCGCGGTGGGCTGGACGGCGACGCCATTGGATGCACGCTTCA
GCACAGTACGTCTTAGCGAGTCCAACATGGGCAACTTTGTCTGTGACGTGATGCGAAGCTTTCATGGCGCCGACT
GTGCCTTGATGGCCTCTGGCACCATTCGTGGAGACCAGATTTACCCGCCAGGCGTTGTTCGCATCAAGGATATTA
CCAATTGCTTTCCCTTTGAGGATGGAGTCATTCTCCTCCGTGTCAAGGGCCAGGCCATCCGCGACGCACTGGAAA
ACGGCGTCTCGACCTATCCAGCCTTGGAAGGTCGCTTTCCTCAGGTGTCGAATATATCCTTTGAATTCAACCCTG
ACAAGGCCAAGGGGAGTAGAATCACCTCTCTCACTATTGGTGGACAAGAGTGCGAGCCAGACAAGTCGTATACTC
TAGCCACTAGAGGATACATGGGACGAGGCAAAGGTAGTGTAGTCAAAAGACAAGATGAGGAAAAAATAACCGAGG
CTGACCCTGTAGCAGATGGATACGAGAGCTTGCTGGTAGAATCCAAGGGCGGCAAAGCCCAGGAAATAGTGGATG
AGGAGAATGGCATCCTGCTATCAGCAATGCTGCGCCAGTACTTTATGAGCCTGCGGACCATTGGGCAGTGGAAGA
AGCTCCCCAGGAATTGGAAGAGCGTGACTGAGGATACCAAGGAATCCACCTCGGCAACAGAGCAGCAGCCTCGCG
ACACCAATAGCCGAGGCAACTACGGCTCCCTGGGCTTGCACAAGGATACAAGTAACAAGGACGACCAAGGAGACG
AGAGCGGGACTGGCGAGGCCGCATGGCGACGTTTTCTCAGACAGCGCCTGGGGCTCGACAAGCAGCCTCCAAGCG
AGGATGACGACGACGACCACTTTGACCCAGACAAGGACACGGGCCAGGGCGACGCAGCGGGAGACGCCGAGACGG
GCATGGACCTGGAGATTTTGTTGCTAAGGAAATTTTGGGCGCGCTGGGTGCTCAAGGCGGGTGTCAAGTCGGCCG
TTTGTGACGCGCTTCACAAGGGAGAGTATGCCGTTGACTGGACGCGTGTGATTGCGCCGACGCTAGAGGGCAGAA
TCAAAATGACTCGAGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail