Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2197
Gene name
LocationContig_167:31512..33707
Strand-
Gene length (bp)2195
Transcript length (bp)2013
Coding sequence length (bp)2013
Protein length (aa) 671

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain 3.6E-36 322 473
PF00149 Metallophos Calcineurin-like phosphoesterase 5.8E-06 30 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A9BJC1|MGGB_PETMO Mannosylglucosyl-3-phosphoglycerate phosphatase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mggB PE=1 SV=1 23 518 3.0E-33
sp|Q9XZ43|5NTD_LUTLO Protein 5NUC OS=Lutzomyia longipalpis GN=5NUC PE=1 SV=1 24 472 5.0E-32
sp|O34313|NTPES_BACSU Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) GN=yfkN PE=1 SV=1 28 491 5.0E-30
sp|Q05927|5NTD_BOVIN 5'-nucleotidase OS=Bos taurus GN=NT5E PE=1 SV=2 25 475 9.0E-29
sp|F8S0Z7|V5NTD_CROAD Snake venom 5'-nucleotidase OS=Crotalus adamanteus PE=1 SV=2 16 475 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A9BJC1|MGGB_PETMO Mannosylglucosyl-3-phosphoglycerate phosphatase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mggB PE=1 SV=1 23 518 3.0E-33
sp|Q9XZ43|5NTD_LUTLO Protein 5NUC OS=Lutzomyia longipalpis GN=5NUC PE=1 SV=1 24 472 5.0E-32
sp|O34313|NTPES_BACSU Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) GN=yfkN PE=1 SV=1 28 491 5.0E-30
sp|Q05927|5NTD_BOVIN 5'-nucleotidase OS=Bos taurus GN=NT5E PE=1 SV=2 25 475 9.0E-29
sp|F8S0Z7|V5NTD_CROAD Snake venom 5'-nucleotidase OS=Crotalus adamanteus PE=1 SV=2 16 475 2.0E-26
sp|Q61503|5NTD_MOUSE 5'-nucleotidase OS=Mus musculus GN=Nt5e PE=1 SV=2 28 490 7.0E-26
sp|P21589|5NTD_HUMAN 5'-nucleotidase OS=Homo sapiens GN=NT5E PE=1 SV=1 14 475 1.0E-25
sp|B6EWW8|V5NTD_GLOBR Snake venom 5'-nucleotidase OS=Gloydius brevicaudus PE=2 SV=1 16 475 1.0E-25
sp|P29240|5NTD_DIPOM 5'-nucleotidase OS=Diplobatis ommata PE=2 SV=1 3 475 4.0E-25
sp|P22848|5NTD_VIBPA 5'-nucleotidase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=nutA PE=3 SV=2 49 475 3.0E-24
sp|Q9KQ30|5NTD_VIBCH 5'-nucleotidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nutA PE=3 SV=1 49 475 7.0E-24
sp|P06196|USHA_SALTY Silent protein UshA(0) OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ushA PE=3 SV=2 28 475 8.0E-24
sp|P07024|USHA_ECOLI Protein UshA OS=Escherichia coli (strain K12) GN=ushA PE=1 SV=2 49 475 1.0E-23
sp|Q8DFG4|5NTD_VIBVU 5'-nucleotidase OS=Vibrio vulnificus (strain CMCP6) GN=nutA PE=3 SV=2 49 475 2.0E-22
sp|Q9RN37|USHA_SALPU Protein UshA OS=Salmonella pullorum GN=ushA PE=3 SV=1 28 475 1.0E-20
sp|Q56878|USHA_YERE8 Protein UshA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ushA PE=3 SV=3 99 475 4.0E-20
sp|B3A0N5|APY_TABYA Apyrase OS=Tabanus yao PE=1 SV=1 41 472 2.0E-19
sp|P21588|5NTD_RAT 5'-nucleotidase OS=Rattus norvegicus GN=Nt5e PE=1 SV=1 28 490 2.0E-19
sp|P54602|YHCR_BACSU Endonuclease YhcR OS=Bacillus subtilis (strain 168) GN=yhcR PE=1 SV=1 8 465 1.0E-18
sp|P52307|5NTD_RHIMP Protein 5NUC (Fragment) OS=Rhipicephalus microplus PE=1 SV=2 30 480 8.0E-18
sp|O34313|NTPES_BACSU Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) GN=yfkN PE=1 SV=1 27 524 2.0E-17
sp|E0D877|APY_AEDAL Apyrase OS=Aedes albopictus PE=1 SV=1 27 514 2.0E-14
sp|P44569|5NTD_HAEIN NAD 5'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0206 PE=1 SV=1 73 242 4.0E-11
sp|P50635|APY_AEDAE Apyrase OS=Aedes aegypti GN=APY PE=1 SV=2 27 475 2.0E-10
sp|P08331|CPDB_ECOLI 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) GN=cpdB PE=1 SV=2 27 263 6.0E-09
sp|O83142|5NTD_TREPA Probable 5'-nucleotidase OS=Treponema pallidum (strain Nichols) GN=TP_0104 PE=3 SV=1 23 242 9.0E-09
sp|P44764|CPDB_HAEIN 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cpdB PE=3 SV=1 91 241 1.0E-08
sp|P26265|CPDB_SALTY 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cpdB PE=3 SV=2 99 255 1.0E-07
sp|P53052|CPDB_YEREN 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Yersinia enterocolitica GN=cpdB PE=3 SV=1 94 253 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009166 nucleotide catabolic process Yes
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0046700 heterocycle catabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0006793 phosphorus metabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901292 nucleoside phosphate catabolic process No
GO:0009117 nucleotide metabolic process No
GO:1901575 organic substance catabolic process No
GO:0046434 organophosphate catabolic process No
GO:0009056 catabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0003824 catalytic activity No
GO:0044248 cellular catabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6562
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|505
Ophiocordyceps australis map64 (Brazil) OphauB2|2197 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2425

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2197
MEAEKKGASSKAQATCWSGRDGSGPPHVRMLHYNDVYHVDQASAEPVGGLARFMTLVDEYRDGQQFQGQPELLTL
FSGDAFNPSLESTVTKGRHMVHVLNAIKTDCACAGNHDFDFGVEQFRHLTEQCNFPWLLANVLDPALGKDVPMGN
AKRTHMMTMGSGIKVGLIGLVEREWLATLNSLPPNVIYKSATATAQELVPQLRQQGADIVICLSHMREPNDNKLA
EQTDGLLDLILGGHDHYYNYSFIKGTHVLRSGSDFKQLSYIEARKRQAKDSNSNARQLWDFDIWRRDVTSEVPEK
EHTAQLVAKLVAKLESSLSRAVGWTATPLDARFSTVRLSESNMGNFVCDVMRSFHGADCALMASGTIRGDQIYPP
GVVRIKDITNCFPFEDGVILLRVKGQAIRDALENGVSTYPALEGRFPQVSNISFEFNPDKAKGSRITSLTIGGQE
CEPDKSYTLATRGYMGRGKDGYESLLVESKGGKAQEIVDEENGILLSAMLRQYFMSLRTIGQWKKLPRNWKSVTE
DTKESTSATEQQPRDTNSRGNYGSLGLHKDTSNKDDQGDESGTGEAAWRRFLRQRLGLDKQPPSEDDDDDHFDPD
KDTGQGDAAGDAETGMDLEILLLRKFWARWVLKAGVKSAVCDALHKGEYAVDWTRVIAPTLEGRIKMTRV*
Coding >OphauB2|2197
ATGGAGGCAGAAAAGAAAGGAGCGTCGTCCAAGGCACAGGCGACTTGCTGGTCAGGCCGAGATGGGTCCGGACCA
CCCCATGTGCGAATGCTGCACTACAATGATGTATACCACGTGGACCAGGCGAGCGCGGAGCCTGTGGGAGGCCTG
GCGCGCTTCATGACCCTCGTCGACGAGTATCGTGATGGGCAGCAGTTCCAGGGACAGCCCGAGCTGCTGACGCTC
TTTTCCGGCGATGCCTTCAACCCCAGCCTGGAGAGCACCGTTACCAAGGGCCGGCACATGGTGCATGTGCTCAAT
GCCATCAAGACGGACTGTGCTTGCGCTGGGAACCATGACTTTGACTTTGGCGTCGAGCAGTTCCGCCACTTGACG
GAGCAGTGCAACTTTCCCTGGCTGCTGGCAAACGTGCTGGATCCAGCTCTGGGCAAGGACGTGCCCATGGGGAAT
GCCAAGCGCACTCACATGATGACAATGGGAAGCGGCATCAAGGTTGGCCTCATTGGCCTGGTGGAGCGGGAGTGG
CTGGCCACTCTCAACAGCCTGCCGCCCAACGTCATTTACAAATCCGCCACGGCAACGGCCCAGGAGCTGGTGCCC
CAGCTGCGGCAGCAGGGCGCAGATATTGTCATTTGTCTAAGCCATATGCGTGAGCCAAACGACAACAAGCTGGCA
GAGCAGACTGACGGGCTCTTGGACCTGATTCTGGGCGGCCATGACCACTACTACAACTACAGCTTCATCAAGGGC
ACCCATGTTCTACGGTCAGGGAGCGACTTCAAGCAGCTAAGCTACATTGAAGCCCGCAAGAGACAGGCAAAAGAC
AGCAACTCGAATGCGCGCCAGCTCTGGGACTTTGACATTTGGCGCCGCGACGTCACCTCCGAGGTGCCTGAAAAG
GAGCACACGGCCCAGCTCGTGGCCAAACTCGTGGCCAAACTGGAAAGCTCACTCTCGCGCGCGGTGGGCTGGACG
GCGACGCCATTGGATGCACGCTTCAGCACAGTACGTCTTAGCGAGTCCAACATGGGCAACTTTGTCTGTGACGTG
ATGCGAAGCTTTCATGGCGCCGACTGTGCCTTGATGGCCTCTGGCACCATTCGTGGAGACCAGATTTACCCGCCA
GGCGTTGTTCGCATCAAGGATATTACCAATTGCTTTCCCTTTGAGGATGGAGTCATTCTCCTCCGTGTCAAGGGC
CAGGCCATCCGCGACGCACTGGAAAACGGCGTCTCGACCTATCCAGCCTTGGAAGGTCGCTTTCCTCAGGTGTCG
AATATATCCTTTGAATTCAACCCTGACAAGGCCAAGGGGAGTAGAATCACCTCTCTCACTATTGGTGGACAAGAG
TGCGAGCCAGACAAGTCGTATACTCTAGCCACTAGAGGATACATGGGACGAGGCAAAGATGGATACGAGAGCTTG
CTGGTAGAATCCAAGGGCGGCAAAGCCCAGGAAATAGTGGATGAGGAGAATGGCATCCTGCTATCAGCAATGCTG
CGCCAGTACTTTATGAGCCTGCGGACCATTGGGCAGTGGAAGAAGCTCCCCAGGAATTGGAAGAGCGTGACTGAG
GATACCAAGGAATCCACCTCGGCAACAGAGCAGCAGCCTCGCGACACCAATAGCCGAGGCAACTACGGCTCCCTG
GGCTTGCACAAGGATACAAGTAACAAGGACGACCAAGGAGACGAGAGCGGGACTGGCGAGGCCGCATGGCGACGT
TTTCTCAGACAGCGCCTGGGGCTCGACAAGCAGCCTCCAAGCGAGGATGACGACGACGACCACTTTGACCCAGAC
AAGGACACGGGCCAGGGCGACGCAGCGGGAGACGCCGAGACGGGCATGGACCTGGAGATTTTGTTGCTAAGGAAA
TTTTGGGCGCGCTGGGTGCTCAAGGCGGGTGTCAAGTCGGCCGTTTGTGACGCGCTTCACAAGGGAGAGTATGCC
GTTGACTGGACGCGTGTGATTGCGCCGACGCTAGAGGGCAGAATCAAAATGACTCGAGTGTAG
Transcript >OphauB2|2197
ATGGAGGCAGAAAAGAAAGGAGCGTCGTCCAAGGCACAGGCGACTTGCTGGTCAGGCCGAGATGGGTCCGGACCA
CCCCATGTGCGAATGCTGCACTACAATGATGTATACCACGTGGACCAGGCGAGCGCGGAGCCTGTGGGAGGCCTG
GCGCGCTTCATGACCCTCGTCGACGAGTATCGTGATGGGCAGCAGTTCCAGGGACAGCCCGAGCTGCTGACGCTC
TTTTCCGGCGATGCCTTCAACCCCAGCCTGGAGAGCACCGTTACCAAGGGCCGGCACATGGTGCATGTGCTCAAT
GCCATCAAGACGGACTGTGCTTGCGCTGGGAACCATGACTTTGACTTTGGCGTCGAGCAGTTCCGCCACTTGACG
GAGCAGTGCAACTTTCCCTGGCTGCTGGCAAACGTGCTGGATCCAGCTCTGGGCAAGGACGTGCCCATGGGGAAT
GCCAAGCGCACTCACATGATGACAATGGGAAGCGGCATCAAGGTTGGCCTCATTGGCCTGGTGGAGCGGGAGTGG
CTGGCCACTCTCAACAGCCTGCCGCCCAACGTCATTTACAAATCCGCCACGGCAACGGCCCAGGAGCTGGTGCCC
CAGCTGCGGCAGCAGGGCGCAGATATTGTCATTTGTCTAAGCCATATGCGTGAGCCAAACGACAACAAGCTGGCA
GAGCAGACTGACGGGCTCTTGGACCTGATTCTGGGCGGCCATGACCACTACTACAACTACAGCTTCATCAAGGGC
ACCCATGTTCTACGGTCAGGGAGCGACTTCAAGCAGCTAAGCTACATTGAAGCCCGCAAGAGACAGGCAAAAGAC
AGCAACTCGAATGCGCGCCAGCTCTGGGACTTTGACATTTGGCGCCGCGACGTCACCTCCGAGGTGCCTGAAAAG
GAGCACACGGCCCAGCTCGTGGCCAAACTCGTGGCCAAACTGGAAAGCTCACTCTCGCGCGCGGTGGGCTGGACG
GCGACGCCATTGGATGCACGCTTCAGCACAGTACGTCTTAGCGAGTCCAACATGGGCAACTTTGTCTGTGACGTG
ATGCGAAGCTTTCATGGCGCCGACTGTGCCTTGATGGCCTCTGGCACCATTCGTGGAGACCAGATTTACCCGCCA
GGCGTTGTTCGCATCAAGGATATTACCAATTGCTTTCCCTTTGAGGATGGAGTCATTCTCCTCCGTGTCAAGGGC
CAGGCCATCCGCGACGCACTGGAAAACGGCGTCTCGACCTATCCAGCCTTGGAAGGTCGCTTTCCTCAGGTGTCG
AATATATCCTTTGAATTCAACCCTGACAAGGCCAAGGGGAGTAGAATCACCTCTCTCACTATTGGTGGACAAGAG
TGCGAGCCAGACAAGTCGTATACTCTAGCCACTAGAGGATACATGGGACGAGGCAAAGATGGATACGAGAGCTTG
CTGGTAGAATCCAAGGGCGGCAAAGCCCAGGAAATAGTGGATGAGGAGAATGGCATCCTGCTATCAGCAATGCTG
CGCCAGTACTTTATGAGCCTGCGGACCATTGGGCAGTGGAAGAAGCTCCCCAGGAATTGGAAGAGCGTGACTGAG
GATACCAAGGAATCCACCTCGGCAACAGAGCAGCAGCCTCGCGACACCAATAGCCGAGGCAACTACGGCTCCCTG
GGCTTGCACAAGGATACAAGTAACAAGGACGACCAAGGAGACGAGAGCGGGACTGGCGAGGCCGCATGGCGACGT
TTTCTCAGACAGCGCCTGGGGCTCGACAAGCAGCCTCCAAGCGAGGATGACGACGACGACCACTTTGACCCAGAC
AAGGACACGGGCCAGGGCGACGCAGCGGGAGACGCCGAGACGGGCATGGACCTGGAGATTTTGTTGCTAAGGAAA
TTTTGGGCGCGCTGGGTGCTCAAGGCGGGTGTCAAGTCGGCCGTTTGTGACGCGCTTCACAAGGGAGAGTATGCC
GTTGACTGGACGCGTGTGATTGCGCCGACGCTAGAGGGCAGAATCAAAATGACTCGAGTGTAG
Gene >OphauB2|2197
ATGGAGGCAGAAAAGAAAGGAGCGTCGTCCAAGGCACAGGCGACTTGCTGGTCAGGCCGAGATGGGTCCGGACCA
CCCCATGTGCGAATGCTGCACTACAATGATGTATACCACGTGGACCAGGCGAGCGCGGAGCCTGTGGGAGGCCTG
GCGCGCTTCATGACCCTCGTCGACGAGTATCGTGATGGGCAGCAGTTCCAGGGACAGCCCGAGCTGCTGACGCTC
TTTTCCGGCGATGCCTTCAACCCCAGCCTGGAGAGCACCGTTACCAAGGGTCAGTCTCGGACGCGAGACACGTGA
CATGAGGCAAGCAGGCTAACACAGGCGCTGTTGCGTATCCAAGGCCGGCACATGGTGCATGTGCTCAATGCCATC
AAGACGGACTGTGCTTGCGCTGGGGTGAGTCTGGGCATGCAAGCTGCCACAAGTCGGCCACTGAGCAATGCCCGC
CGCAGAACCATGACTTTGACTTTGGCGTCGAGCAGTTCCGCCACTTGACGGAGCAGTGCAACTTTCCCTGGCTGC
TGGCAAACGTGCTGGATCCAGCTCTGGGCAAGGACGTGCCCATGGGGAATGCCAAGCGCACTCACATGATGACAA
TGGGAAGCGGCATCAAGGTTGGCCTCATTGGCCTGGTGGAGCGGGAGTGGCTGGCCACTCTCAACAGCCTGCCGC
CCAACGTCATTTACAAATCCGCCACGGCAACGGCCCAGGAGCTGGTGCCCCAGCTGCGGCAGCAGGGCGCAGATA
TTGTCATTTGTCTAAGCCATATGCGTGAGCCAAACGACAACAAGCTGGCAGAGCAGACTGACGGGCTCTTGGACC
TGATTCTGGGCGGCCATGACCACTACTACAACTACAGCTTCATCAAGGGCACCCATGTTCTACGGTCAGGGAGCG
ACTTCAAGCAGCTAAGCTACATTGAAGCCCGCAAGAGACAGGCAAAAGACAGCAACTCGAATGCGCGCCAGCTCT
GGGACTTTGACATTTGGCGCCGCGACGTCACCTCCGAGGTGCCTGAAAAGGAGCACACGGCCCAGCTCGTGGCCA
AACTCGTGGCCAAACTGGAAAGCTCACTCTCGCGCGCGGTGGGCTGGACGGCGACGCCATTGGATGCACGCTTCA
GCACAGTACGTCTTAGCGAGTCCAACATGGGCAACTTTGTCTGTGACGTGATGCGAAGCTTTCATGGCGCCGACT
GTGCCTTGATGGCCTCTGGCACCATTCGTGGAGACCAGATTTACCCGCCAGGCGTTGTTCGCATCAAGGATATTA
CCAATTGCTTTCCCTTTGAGGATGGAGTCATTCTCCTCCGTGTCAAGGGCCAGGCCATCCGCGACGCACTGGAAA
ACGGCGTCTCGACCTATCCAGCCTTGGAAGGTCGCTTTCCTCAGGTGTCGAATATATCCTTTGAATTCAACCCTG
ACAAGGCCAAGGGGAGTAGAATCACCTCTCTCACTATTGGTGGACAAGAGTGCGAGCCAGACAAGTCGTATACTC
TAGCCACTAGAGGATACATGGGACGAGGCAAAGGTAGTGTAGTCAAAAGACAAGATGAGGAAAAAATAACCGAGG
CTGACCCTGTAGCAGATGGATACGAGAGCTTGCTGGTAGAATCCAAGGGCGGCAAAGCCCAGGAAATAGTGGATG
AGGAGAATGGCATCCTGCTATCAGCAATGCTGCGCCAGTACTTTATGAGCCTGCGGACCATTGGGCAGTGGAAGA
AGCTCCCCAGGAATTGGAAGAGCGTGACTGAGGATACCAAGGAATCCACCTCGGCAACAGAGCAGCAGCCTCGCG
ACACCAATAGCCGAGGCAACTACGGCTCCCTGGGCTTGCACAAGGATACAAGTAACAAGGACGACCAAGGAGACG
AGAGCGGGACTGGCGAGGCCGCATGGCGACGTTTTCTCAGACAGCGCCTGGGGCTCGACAAGCAGCCTCCAAGCG
AGGATGACGACGACGACCACTTTGACCCAGACAAGGACACGGGCCAGGGCGACGCAGCGGGAGACGCCGAGACGG
GCATGGACCTGGAGATTTTGTTGCTAAGGAAATTTTGGGCGCGCTGGGTGCTCAAGGCGGGTGTCAAGTCGGCCG
TTTGTGACGCGCTTCACAAGGGAGAGTATGCCGTTGACTGGACGCGTGTGATTGCGCCGACGCTAGAGGGCAGAA
TCAAAATGACTCGAGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail