Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2196
Gene name
LocationContig_167:30257..31159
Strand+
Gene length (bp)902
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 2.4E-39 9 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 8 200 3.0E-34
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 8 200 7.0E-34
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 24 202 1.0E-21
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 13 195 6.0E-20
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 24 206 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 8 200 3.0E-34
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 8 200 7.0E-34
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 24 202 1.0E-21
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 13 195 6.0E-20
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 24 206 6.0E-20
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 24 195 3.0E-18
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 10 205 3.0E-18
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 4 225 6.0E-18
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 24 195 8.0E-18
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 24 203 1.0E-17
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 25 202 1.0E-17
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 25 202 2.0E-17
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 11 203 2.0E-17
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 24 222 2.0E-17
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 6 211 2.0E-17
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 3 202 3.0E-17
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 13 198 1.0E-16
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 7 198 3.0E-16
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 5 195 3.0E-16
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 6 226 3.0E-16
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 7 200 5.0E-16
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 6 213 5.0E-16
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 5 214 5.0E-16
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 4 207 6.0E-16
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 24 196 7.0E-16
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 4 211 9.0E-16
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 5 214 9.0E-16
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 24 213 1.0E-15
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 10 227 1.0E-15
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 6 225 1.0E-15
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 8 195 1.0E-15
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 24 198 1.0E-15
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 24 197 1.0E-15
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 24 196 1.0E-15
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 8 230 1.0E-15
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 6 225 2.0E-15
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 9 222 2.0E-15
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 25 194 2.0E-15
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 10 241 3.0E-15
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 9 198 3.0E-15
sp|Q09660|CC44_CAEEL Probable cytochrome P450 CYP44 OS=Caenorhabditis elegans GN=cyp-44A1 PE=3 SV=2 26 214 3.0E-15
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 4 226 4.0E-15
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 3 194 4.0E-15
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 5 214 4.0E-15
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 24 202 5.0E-15
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 24 214 5.0E-15
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 24 198 6.0E-15
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 6 211 7.0E-15
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 10 198 7.0E-15
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 7 194 7.0E-15
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 24 223 1.0E-14
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 10 210 1.0E-14
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 10 225 2.0E-14
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 10 230 2.0E-14
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 25 225 2.0E-14
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 12 211 2.0E-14
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 7 207 3.0E-14
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 24 198 3.0E-14
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 10 204 3.0E-14
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 11 215 3.0E-14
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 8 183 3.0E-14
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 1 194 3.0E-14
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 24 198 3.0E-14
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 10 198 4.0E-14
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 25 198 5.0E-14
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 10 229 6.0E-14
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 11 203 6.0E-14
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 11 195 6.0E-14
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 12 211 7.0E-14
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 12 211 7.0E-14
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 1 212 7.0E-14
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 7 194 1.0E-13
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 11 195 1.0E-13
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 16 198 1.0E-13
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 7 207 1.0E-13
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 9 198 2.0E-13
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 21 194 2.0E-13
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 7 194 2.0E-13
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 21 199 2.0E-13
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 24 198 2.0E-13
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 11 195 2.0E-13
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 1 207 2.0E-13
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 10 216 3.0E-13
sp|Q64408|C11B1_CAVPO Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 16 194 3.0E-13
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 24 198 3.0E-13
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 10 203 3.0E-13
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 25 199 3.0E-13
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 14 198 4.0E-13
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 13 225 4.0E-13
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 7 194 4.0E-13
sp|Q9V6D6|CP301_DROME Probable cytochrome P450 301a1, mitochondrial OS=Drosophila melanogaster GN=Cyp301a1 PE=2 SV=1 24 216 4.0E-13
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 24 222 4.0E-13
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 21 195 4.0E-13
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 7 198 5.0E-13
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 1 196 5.0E-13
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 24 198 5.0E-13
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 26 195 6.0E-13
sp|Q54F47|C513C_DICDI Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 7 226 7.0E-13
sp|Q1ZXG6|C5131_DICDI Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 1 206 8.0E-13
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 7 227 1.0E-12
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 21 194 1.0E-12
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 1 199 1.0E-12
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 25 203 1.0E-12
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 9 196 1.0E-12
sp|Q54WB9|C513D_DICDI Probable cytochrome P450 513D1 OS=Dictyostelium discoideum GN=cyp513D1 PE=3 SV=1 24 197 1.0E-12
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 10 226 1.0E-12
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 24 195 1.0E-12
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 7 198 1.0E-12
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 13 195 2.0E-12
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 10 230 2.0E-12
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 25 198 2.0E-12
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 10 198 2.0E-12
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 21 194 2.0E-12
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 10 200 2.0E-12
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 9 195 2.0E-12
sp|Q64658|C11B2_MESAU Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 21 194 2.0E-12
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 24 195 2.0E-12
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 25 199 2.0E-12
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 12 228 3.0E-12
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 8 198 3.0E-12
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 8 198 3.0E-12
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 25 198 3.0E-12
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 7 207 4.0E-12
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 24 194 4.0E-12
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 9 200 5.0E-12
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 15 198 5.0E-12
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 12 225 5.0E-12
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 3 204 5.0E-12
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 7 200 5.0E-12
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 24 198 5.0E-12
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 21 200 6.0E-12
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 7 198 6.0E-12
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 25 198 6.0E-12
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 24 238 6.0E-12
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 10 197 7.0E-12
sp|Q554S4|C519A_DICDI Probable cytochrome P450 519A1 OS=Dictyostelium discoideum GN=cyp519A1 PE=3 SV=1 24 157 7.0E-12
sp|Q50LE0|C85A3_SOLLC Cytochrome P450 85A3 OS=Solanum lycopersicum GN=CYP85A3 PE=2 SV=1 10 223 7.0E-12
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 7 209 7.0E-12
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 24 194 7.0E-12
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 5 208 7.0E-12
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 7 198 8.0E-12
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 10 203 8.0E-12
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 25 202 9.0E-12
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 7 198 9.0E-12
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 24 198 1.0E-11
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 7 198 1.0E-11
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 10 199 1.0E-11
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 24 196 1.0E-11
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 25 230 1.0E-11
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 13 225 1.0E-11
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 13 229 1.0E-11
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 25 198 1.0E-11
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 21 194 2.0E-11
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 25 198 2.0E-11
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 2 197 2.0E-11
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 10 213 2.0E-11
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 19 196 2.0E-11
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 26 198 2.0E-11
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 7 204 2.0E-11
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 10 213 2.0E-11
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 8 198 3.0E-11
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 8 198 3.0E-11
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 26 205 3.0E-11
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 10 179 3.0E-11
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 9 207 3.0E-11
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 1 227 3.0E-11
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 24 195 3.0E-11
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 24 240 3.0E-11
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 24 240 3.0E-11
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 1 194 4.0E-11
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 13 198 4.0E-11
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 10 199 4.0E-11
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 24 198 4.0E-11
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 24 179 4.0E-11
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 24 203 4.0E-11
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 10 196 4.0E-11
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 24 199 4.0E-11
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 10 207 4.0E-11
sp|Q9VG40|CP134_DROME Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 8 196 5.0E-11
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 6 194 5.0E-11
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 24 230 5.0E-11
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 19 206 5.0E-11
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 7 194 5.0E-11
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 10 200 6.0E-11
sp|Q9FH66|C71AG_ARATH Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1 5 198 6.0E-11
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 25 194 6.0E-11
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 26 196 6.0E-11
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 24 198 6.0E-11
sp|P9WPM9|C135B_MYCTU Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 10 204 7.0E-11
sp|P9WPM8|C135B_MYCTO Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 10 204 7.0E-11
sp|P63716|C135B_MYCBO Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 10 204 7.0E-11
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 10 213 7.0E-11
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 6 205 7.0E-11
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 3 204 8.0E-11
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 7 200 8.0E-11
sp|Q9VG17|CP304_DROME Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=2 SV=2 9 226 8.0E-11
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 3 203 8.0E-11
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 7 198 8.0E-11
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 25 214 8.0E-11
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 26 196 9.0E-11
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 14 196 9.0E-11
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 25 198 9.0E-11
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 10 204 1.0E-10
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 25 195 1.0E-10
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 24 198 1.0E-10
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 10 198 1.0E-10
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 24 199 1.0E-10
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 9 198 1.0E-10
sp|Q3LFT9|CP1A2_BALAC Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 14 198 1.0E-10
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 3 204 1.0E-10
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 24 198 2.0E-10
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 25 198 2.0E-10
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 25 226 2.0E-10
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 24 198 2.0E-10
sp|P30611|CP52N_CANTR Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 24 195 2.0E-10
sp|Q50EK3|C04C1_PINTA Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 9 217 2.0E-10
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 24 194 2.0E-10
sp|P19099|C11B2_HUMAN Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 21 176 2.0E-10
sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 4 209 3.0E-10
sp|Q2XV99|CP11A_MACFA Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 7 201 3.0E-10
sp|P56592|CP1A2_CANLF Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 7 198 3.0E-10
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 1 198 3.0E-10
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 24 207 3.0E-10
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 7 205 3.0E-10
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 25 194 3.0E-10
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 24 198 3.0E-10
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 13 207 3.0E-10
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 25 200 4.0E-10
sp|O43174|CP26A_HUMAN Cytochrome P450 26A1 OS=Homo sapiens GN=CYP26A1 PE=2 SV=2 25 206 4.0E-10
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 10 234 4.0E-10
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 9 214 4.0E-10
sp|O55127|CP26A_MOUSE Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE=2 SV=1 25 226 4.0E-10
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 25 202 4.0E-10
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 6 225 5.0E-10
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 25 195 5.0E-10
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 12 196 5.0E-10
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 1 205 5.0E-10
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 25 198 5.0E-10
sp|Q43033|TCMO_PETCR Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1 8 196 5.0E-10
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 10 213 5.0E-10
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 25 198 6.0E-10
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 24 194 6.0E-10
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 1 198 6.0E-10
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 21 195 6.0E-10
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 25 198 6.0E-10
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 25 226 6.0E-10
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 25 226 6.0E-10
sp|Q9EPT4|CP11A_MESAU Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 1 194 6.0E-10
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 1 196 6.0E-10
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 7 201 7.0E-10
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 7 198 7.0E-10
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 7 199 7.0E-10
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 7 198 7.0E-10
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 2 198 7.0E-10
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 13 225 7.0E-10
sp|P15538|C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 21 176 8.0E-10
sp|O77810|CP1A2_CALJA Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 8 198 8.0E-10
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 24 198 8.0E-10
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 25 198 8.0E-10
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 24 198 9.0E-10
sp|O13345|ORDA_ASPPA O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 17 183 9.0E-10
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 24 205 9.0E-10
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 25 199 1.0E-09
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 25 197 1.0E-09
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 24 195 1.0E-09
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 10 194 1.0E-09
sp|Q29527|C11B1_PAPHU Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 21 176 1.0E-09
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 14 194 1.0E-09
sp|P21595|CP56_YEAST Cytochrome P450-DIT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIT2 PE=1 SV=2 14 198 1.0E-09
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 26 196 1.0E-09
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 7 194 1.0E-09
sp|Q5UQ90|YL532_MIMIV Cytochrome P450-like protein L532 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L532 PE=1 SV=1 14 205 1.0E-09
sp|P33265|CP2CS_MESAU Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 10 195 1.0E-09
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 6 227 1.0E-09
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 25 198 1.0E-09
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 25 197 1.0E-09
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 9 199 1.0E-09
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 3 213 1.0E-09
sp|Q2XNC9|CP2D6_PANPA Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 25 198 1.0E-09
sp|Q2XNC8|CP2D6_PANTR Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 25 198 2.0E-09
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 13 196 2.0E-09
sp|P05108|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 7 201 2.0E-09
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 25 195 2.0E-09
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 8 210 2.0E-09
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 25 198 2.0E-09
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 25 196 2.0E-09
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 3 179 2.0E-09
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 25 208 2.0E-09
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 10 198 2.0E-09
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 9 198 2.0E-09
sp|Q9VHP4|CP313_DROME Probable cytochrome P450 313b1 OS=Drosophila melanogaster GN=Cyp313b1 PE=2 SV=2 8 194 2.0E-09
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 8 215 2.0E-09
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 24 225 2.0E-09
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 24 196 3.0E-09
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 10 198 3.0E-09
sp|B8NHY4|ORDA_ASPFN O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 17 183 3.0E-09
sp|Q5VDD6|ORDA_ASPFL O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 17 183 3.0E-09
sp|Q12585|CP52T_CANMA Cytochrome P450 52D1 OS=Candida maltosa GN=CYP52D1 PE=2 SV=1 24 190 3.0E-09
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 24 179 3.0E-09
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 25 195 3.0E-09
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 7 198 3.0E-09
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 10 194 3.0E-09
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 25 195 3.0E-09
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 24 222 3.0E-09
sp|Q54KV0|C513B_DICDI Probable cytochrome P450 513B1 OS=Dictyostelium discoideum GN=cyp513B1 PE=3 SV=1 8 196 3.0E-09
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 8 209 3.0E-09
sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 25 198 4.0E-09
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 10 198 4.0E-09
sp|Q29488|CP2DH_MACFA Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 25 198 4.0E-09
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 25 195 4.0E-09
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 5 175 4.0E-09
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 25 196 5.0E-09
sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 8 179 5.0E-09
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 1 195 5.0E-09
sp|P14137|CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 1 194 5.0E-09
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 24 194 5.0E-09
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 12 194 6.0E-09
sp|H2KYS3|DAF9_CAEEL Cytochrome P450 daf-9 OS=Caenorhabditis elegans GN=daf-9 PE=1 SV=1 24 198 6.0E-09
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 7 228 6.0E-09
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 25 198 6.0E-09
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 9 196 6.0E-09
sp|P05179|CP2C7_RAT Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 25 200 7.0E-09
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 12 199 7.0E-09
sp|P00189|CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 25 201 7.0E-09
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 10 197 8.0E-09
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 13 195 8.0E-09
sp|Q54SN0|C513E_DICDI Probable cytochrome P450 513E1 OS=Dictyostelium discoideum GN=cyp513E1 PE=3 SV=1 1 196 8.0E-09
sp|Q9QZ82|CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 1 194 9.0E-09
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 1 196 9.0E-09
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 9 199 9.0E-09
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 24 198 9.0E-09
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 13 225 1.0E-08
sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 25 198 1.0E-08
sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 25 198 1.0E-08
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 24 198 1.0E-08
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 9 195 1.0E-08
sp|P17666|CP2CE_RABIT Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 10 194 1.0E-08
sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 25 199 1.0E-08
sp|P10610|CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 25 194 1.0E-08
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 6 224 1.0E-08
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 9 194 1.0E-08
sp|Q5QQX7|CP19A_CANLF Aromatase OS=Canis lupus familiaris GN=CYP19A1 PE=2 SV=1 8 194 1.0E-08
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 25 195 1.0E-08
sp|Q92039|CP1A1_CHACA Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 25 196 1.0E-08
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 8 196 1.0E-08
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 17 202 1.0E-08
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 25 194 1.0E-08
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 13 198 2.0E-08
sp|P9WPP9|CP51_MYCTU Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 10 214 2.0E-08
sp|P9WPP8|CP51_MYCTO Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 10 214 2.0E-08
sp|P0A513|CP51_MYCBO Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 10 214 2.0E-08
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 9 196 2.0E-08
sp|Q42569|C90A1_ARATH Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1 7 203 2.0E-08
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 25 194 2.0E-08
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 10 198 2.0E-08
sp|P10612|CP11A_PIG Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 10 200 2.0E-08
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 6 214 2.0E-08
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 8 204 2.0E-08
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 25 198 2.0E-08
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 25 195 2.0E-08
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 25 195 3.0E-08
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 10 222 3.0E-08
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 14 195 3.0E-08
sp|O13820|ERG5_SCHPO Cytochrome P450 61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg5 PE=1 SV=3 25 183 3.0E-08
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 25 203 3.0E-08
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 25 203 3.0E-08
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 25 194 3.0E-08
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 9 214 3.0E-08
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 25 203 3.0E-08
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 24 198 3.0E-08
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 19 198 3.0E-08
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 25 194 3.0E-08
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 24 199 3.0E-08
sp|B5UAQ8|C7195_ESCCA Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 5 197 3.0E-08
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 15 210 4.0E-08
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 25 198 4.0E-08
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 24 204 4.0E-08
sp|Q92109|CP1A3_ONCMY Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 25 204 4.0E-08
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 10 198 4.0E-08
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 24 196 4.0E-08
sp|Q50EK1|C16B1_PICSI Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 9 200 4.0E-08
sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 9 198 4.0E-08
sp|Q50EK0|C16B2_PICSI Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1 9 200 4.0E-08
sp|Q6V0L0|CP26C_HUMAN Cytochrome P450 26C1 OS=Homo sapiens GN=CYP26C1 PE=2 SV=2 16 192 5.0E-08
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 10 207 5.0E-08
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 25 198 6.0E-08
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 7 194 6.0E-08
sp|Q9C788|C70B1_ARATH Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 7 226 6.0E-08
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 25 198 7.0E-08
sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 1 195 7.0E-08
sp|Q501D8|C79B3_ARATH Tryptophan N-monooxygenase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1 10 211 7.0E-08
sp|P12789|CP2B5_RABIT Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 14 194 8.0E-08
sp|Q92116|CP1A1_STECH Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 25 183 8.0E-08
sp|Q9SAE4|C71BT_ARATH Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 10 210 8.0E-08
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 25 198 8.0E-08
sp|C0SPF7|C15C1_BOMMO Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 25 198 8.0E-08
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 13 198 8.0E-08
sp|P15149|CP2A2_RAT Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 3 207 8.0E-08
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 9 201 9.0E-08
sp|Q6WNQ9|C81E9_MEDTR Isoflavone 3'-hydroxylase (Fragment) OS=Medicago truncatula GN=CYP81E9 PE=1 SV=1 24 180 9.0E-08
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 24 229 9.0E-08
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 9 196 1.0E-07
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 10 204 1.0E-07
sp|P0DKI2|C76AN_BETVU Inactive cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=3 SV=1 3 143 1.0E-07
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 10 204 1.0E-07
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 9 198 1.0E-07
sp|P20813|CP2B6_HUMAN Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 25 194 1.0E-07
sp|Q9JKJ9|CP39A_MOUSE 24-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp39a1 PE=1 SV=1 37 199 1.0E-07
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 7 195 1.0E-07
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 25 198 1.0E-07
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 25 226 1.0E-07
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 9 196 1.0E-07
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 9 213 1.0E-07
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 25 226 1.0E-07
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 25 226 1.0E-07
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 24 194 1.0E-07
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 10 213 1.0E-07
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 25 191 1.0E-07
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 24 194 1.0E-07
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 25 194 1.0E-07
sp|Q9V558|CP4P1_DROME Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 7 194 1.0E-07
sp|Q42797|TCMO_SOYBN Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 8 179 1.0E-07
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 24 198 1.0E-07
sp|O81346|C79B2_ARATH Tryptophan N-monooxygenase 1 OS=Arabidopsis thaliana GN=CYP79B2 PE=1 SV=2 10 211 2.0E-07
sp|A1DA63|FTME_NEOFI Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 26 227 2.0E-07
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 24 198 2.0E-07
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 8 198 2.0E-07
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 7 195 2.0E-07
sp|P04799|CP1A2_RAT Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2 PE=1 SV=2 7 198 2.0E-07
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 19 199 2.0E-07
sp|P79402|CP242_PIG Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 25 199 2.0E-07
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 25 226 2.0E-07
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 25 199 2.0E-07
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 26 197 2.0E-07
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 74 197 2.0E-07
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 25 198 2.0E-07
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 11 207 2.0E-07
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 25 200 3.0E-07
sp|O42457|CP1A1_SPAAU Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 25 190 3.0E-07
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 24 198 3.0E-07
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 7 214 3.0E-07
sp|Q8GSQ1|C85A1_ORYSJ Cytochrome P450 85A1 OS=Oryza sativa subsp. japonica GN=CYP85A1 PE=1 SV=1 11 183 3.0E-07
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 24 198 3.0E-07
sp|P20814|CP2CD_RAT Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 25 194 3.0E-07
sp|Q9FUY7|C79F2_ARATH Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 10 207 3.0E-07
sp|P12938|CP2D3_RAT Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 25 198 3.0E-07
sp|P03940|CP21A_MOUSE Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 24 194 3.0E-07
sp|Q55BU9|C5133_DICDI Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 25 196 3.0E-07
sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 44 198 3.0E-07
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 25 198 3.0E-07
sp|Q95M61|CP19A_CALJA Aromatase OS=Callithrix jacchus GN=CYP19A1 PE=2 SV=2 8 194 4.0E-07
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 9 198 4.0E-07
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 10 222 4.0E-07
sp|P9WPN1|C135A_MYCTU Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135A1 PE=1 SV=1 10 197 4.0E-07
sp|P9WPN0|C135A_MYCTO Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135A1 PE=3 SV=1 10 197 4.0E-07
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 7 198 4.0E-07
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 1 209 4.0E-07
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 9 196 4.0E-07
sp|Q92110|CP1A1_ONCMY Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 25 204 4.0E-07
sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 24 198 5.0E-07
sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 25 198 5.0E-07
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 1 195 5.0E-07
sp|P19100|CP17A_PIG Steroid 17-alpha-hydroxylase/17,20 lyase OS=Sus scrofa GN=CYP17A1 PE=2 SV=3 25 226 5.0E-07
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 1 194 5.0E-07
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 25 198 5.0E-07
sp|Q9V4I1|CP9B2_DROME Cytochrome P450 9b2 OS=Drosophila melanogaster GN=Cyp9b2 PE=2 SV=1 11 194 5.0E-07
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 10 222 6.0E-07
sp|P33273|CP255_RAT Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 10 195 6.0E-07
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 24 198 6.0E-07
sp|Q9NYL5|CP39A_HUMAN 24-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP39A1 PE=2 SV=2 68 199 7.0E-07
sp|Q949U1|C79F1_ARATH Dihomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F1 PE=1 SV=1 10 228 7.0E-07
sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 1 195 7.0E-07
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 24 183 7.0E-07
sp|O42231|CP1A1_LIZAU Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 25 196 8.0E-07
sp|Q64562|CP21A_RAT Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 24 194 8.0E-07
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 10 192 8.0E-07
sp|Q04468|TCMO_HELTU Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 8 179 8.0E-07
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 25 194 8.0E-07
sp|Q43240|TCMO_ZINVI Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 8 179 9.0E-07
sp|P48522|TCMO_CATRO Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 8 179 9.0E-07
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 12 198 9.0E-07
sp|Q96423|TCMO_GLYEC Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 8 179 9.0E-07
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 13 225 9.0E-07
sp|O46658|CP2DP_PIG Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 25 198 1.0E-06
sp|Q9LMX7|C78A5_ARATH Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 9 196 1.0E-06
sp|Q9GLD2|CP17A_PAPHU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 25 226 1.0E-06
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 10 195 1.0E-06
sp|P37115|TCMO_VIGRR Trans-cinnamate 4-monooxygenase OS=Vigna radiata var. radiata GN=CYP73A2 PE=1 SV=1 8 179 1.0E-06
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 10 175 1.0E-06
sp|P58045|C71AE_ARATH Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 24 196 1.0E-06
sp|Q95328|CP17A_HORSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 25 226 1.0E-06
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 9 224 2.0E-06
sp|O42145|C19AA_DANRE Aromatase OS=Danio rerio GN=cyp19a1a PE=2 SV=1 8 194 2.0E-06
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 25 195 2.0E-06
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 10 194 2.0E-06
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 25 200 2.0E-06
sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 25 198 2.0E-06
sp|Q64403|CP2DG_CAVPO Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 25 198 3.0E-06
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 25 200 3.0E-06
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 10 175 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2196
MMQSFIDGGLTRDELMQEVFVETVAGSDTTATAIRSTLLCLLGNPLALTTLRREIDDAASCGAISSPIRDSEARQ
MPYLQAVIREGIRMFPPATGVLSKQVPLGGDCILGYQVPAGVQVGHNICGLLRMTELFGPDAQLFRPERWLEAES
DPQRLKEMVGAVELVFGYGKFQCLGRTIAQMELNKVFVELLRRFDFTIVHVEKPMRLLSAAMLIMDDFWVRVSRR
QEPAPFGGVVGKLEHV*
Coding >OphauB2|2196
ATGATGCAGTCCTTTATCGACGGCGGGCTCACTCGAGACGAGCTGATGCAAGAAGTCTTTGTCGAGACCGTTGCC
GGCTCTGATACAACAGCCACGGCCATTCGATCAACCCTTCTCTGCCTACTAGGCAACCCCCTCGCCCTCACAACT
CTACGCCGCGAAATCGACGACGCCGCTTCTTGTGGCGCCATTTCATCTCCCATACGCGACAGCGAGGCCCGTCAA
ATGCCCTATCTCCAGGCCGTCATCCGCGAAGGCATCCGCATGTTCCCCCCAGCCACTGGCGTCTTGTCCAAGCAA
GTGCCTCTTGGAGGCGACTGCATTCTCGGATATCAAGTGCCCGCCGGTGTCCAAGTTGGCCACAACATTTGCGGC
CTGTTGCGCATGACGGAGCTGTTTGGCCCTGATGCCCAACTGTTTCGCCCTGAGCGCTGGCTGGAAGCCGAGAGT
GACCCGCAGCGCCTCAAGGAAATGGTGGGGGCCGTCGAACTCGTTTTTGGGTACGGCAAGTTTCAGTGCTTGGGC
AGGACGATAGCTCAGATGGAGCTCAACAAGGTCTTTGTCGAGCTTTTACGGAGATTCGACTTTACCATTGTTCAC
GTGGAAAAGCCCATGCGGCTCCTCAGTGCCGCCATGCTCATCATGGACGACTTTTGGGTTCGTGTCTCGAGGCGA
CAGGAACCTGCACCATTTGGCGGAGTGGTGGGCAAACTAGAGCATGTATAA
Transcript >OphauB2|2196
ATGATGCAGTCCTTTATCGACGGCGGGCTCACTCGAGACGAGCTGATGCAAGAAGTCTTTGTCGAGACCGTTGCC
GGCTCTGATACAACAGCCACGGCCATTCGATCAACCCTTCTCTGCCTACTAGGCAACCCCCTCGCCCTCACAACT
CTACGCCGCGAAATCGACGACGCCGCTTCTTGTGGCGCCATTTCATCTCCCATACGCGACAGCGAGGCCCGTCAA
ATGCCCTATCTCCAGGCCGTCATCCGCGAAGGCATCCGCATGTTCCCCCCAGCCACTGGCGTCTTGTCCAAGCAA
GTGCCTCTTGGAGGCGACTGCATTCTCGGATATCAAGTGCCCGCCGGTGTCCAAGTTGGCCACAACATTTGCGGC
CTGTTGCGCATGACGGAGCTGTTTGGCCCTGATGCCCAACTGTTTCGCCCTGAGCGCTGGCTGGAAGCCGAGAGT
GACCCGCAGCGCCTCAAGGAAATGGTGGGGGCCGTCGAACTCGTTTTTGGGTACGGCAAGTTTCAGTGCTTGGGC
AGGACGATAGCTCAGATGGAGCTCAACAAGGTCTTTGTCGAGCTTTTACGGAGATTCGACTTTACCATTGTTCAC
GTGGAAAAGCCCATGCGGCTCCTCAGTGCCGCCATGCTCATCATGGACGACTTTTGGGTTCGTGTCTCGAGGCGA
CAGGAACCTGCACCATTTGGCGGAGTGGTGGGCAAACTAGAGCATGTATAA
Gene >OphauB2|2196
ATGATGCAGTCCTTTATCGACGGCGGGCTCACTCGAGACGAGCTGATGCAAGAAGTCTTTGTCGAGACGTAAGTC
CTTCTCTCTCTCCCCCCCCCCCTCCTCCCAATCTCCCTCTCCTTGGCCTCGGCACCTCTTTGAAAATCATACTTA
ATCCGTCTGTCCCAGCGTTGCCGGCTCTGATACAACAGCCACGGCCATTCGATCAACCCTTCTCTGCCTACTAGG
CAACCCCCTCGCCCTCACAACTCTACGCCGCGAAATCGACGACGCCGCTTCTTGTGGCGCCATTTCATCTCCCAT
ACGCGACAGCGAGGCCCGTCAAATGCCCTATCTCCAGGCCGTCATCCGCGAAGGCATCCGCATGTTCCCCCCAGC
CACTGGCGTCTTGTCCAAGCAAGTGCCTCTTGGAGGCGACTGCATTCTCGGATATCAAGTGCCCGCCGGTGTCCA
AGTTGGCCACAACATTTGCGGCCTGTTGCGCATGACGGAGCTGTTTGGCCCTGATGCCCAACTGTTTCGCCCTGA
GCGCTGGCTGGAAGCCGAGAGTGACCCGCAGCGCCTCAAGGAAATGGTGGGGGCCGTCGAACTCGTTTTTGGGTA
CGGCAAGTTTCAGTGCTTGGGCAGGACGATAGCTCAGATGGAGCTCAACAAGGTCTTTGTCGAGGTATGTAGATT
TGGGCTTGACGAGATAATTTTACACTTTTTTTTAGGGGGGGAGGGATACTGACCCGGCAATGCTGCAGCTTTTAC
GGAGATTCGACTTTACCATTGTTCACGTGGAAAAGCCCATGCGGCTCCTCAGTGCCGCCATGCTCATCATGGACG
ACTTTTGGGTTCGTGTCTCGAGGCGACAGGAACCTGCACCATTTGGCGGAGTGGTGGGCAAACTAGAGCATGTAT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail