Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2192
Gene name
LocationContig_167:22548..23661
Strand+
Gene length (bp)1113
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01212 Beta_elim_lyase Beta-eliminating lyase 8.3E-34 30 307
PF00155 Aminotran_1_2 Aminotransferase class I and II 5.4E-05 27 189

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O50584|LTAE_PSEUN Low specificity L-threonine aldolase OS=Pseudomonas sp. (strain NCIMB 10558) GN=ltaE PE=1 SV=1 19 351 3.0E-42
sp|Q9HTF1|LTAE_PSEAE Low specificity L-threonine aldolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ltaE PE=3 SV=1 18 355 3.0E-37
sp|P37303|GLY1_YEAST Low specificity L-threonine aldolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLY1 PE=1 SV=2 30 305 9.0E-07
sp|O74267|GLY1_ASHGO Low-specificity L-threonine aldolase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLY1 PE=3 SV=3 30 305 8.0E-06

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016829 lyase activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:0003824 catalytic activity No
GO:0019842 vitamin binding No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043436 oxoacid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0070279 vitamin B6 binding No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2192
MPNASLSNGDYCPKPRYSFLDDYGEGAHPEVLEALVASNGTQEAGYGKDRYSAEARGHIRRHLGDDAGDVGIFFV
PGGTSANAISIAACLRPHEAVIAASSAHIVTRETGAVEATGHKIINAPPVNGKLTPDAIIKALDENWHYPHMARP
RLVYISNATEIGTVYSAHELRALRRLCDERRLLLFMDGARLGAALTSAVNDVSLPDVLRLTDIFWIGGTKNGALL
GEAVVVKDPSLALDYDFYVKQHGSLLAKSRVMGVEFAQLFRHHLYFDLARDANAAADKLSRSILGAGFVLHAATE
TNQVFAILPLGLIKMLQHHFLFYLWEKHDAGWGVIRLLTTWATEPAQVEKFNKMVLAWTPEHNGFCNSNA*
Coding >OphauB2|2192
ATGCCCAACGCCAGCCTCTCCAACGGCGACTACTGCCCCAAGCCGAGATACAGCTTTCTAGACGACTATGGCGAG
GGCGCACATCCCGAGGTGCTCGAGGCGCTCGTGGCCAGCAACGGCACGCAAGAAGCCGGCTATGGCAAGGATCGC
TACAGCGCCGAGGCTCGAGGGCATATTCGCCGGCACTTGGGCGACGATGCAGGCGACGTGGGCATATTTTTTGTG
CCGGGCGGGACATCGGCCAATGCCATTTCCATTGCGGCCTGTCTGCGGCCTCACGAGGCAGTCATTGCCGCCAGC
TCTGCGCACATTGTGACGCGCGAGACGGGAGCCGTCGAGGCAACGGGCCACAAGATTATCAATGCGCCGCCCGTC
AATGGCAAGCTGACGCCCGACGCCATTATCAAGGCGCTCGACGAGAACTGGCACTACCCGCACATGGCGCGGCCT
CGCCTGGTGTACATTTCCAATGCCACCGAAATTGGCACCGTCTACTCTGCCCACGAGCTGCGCGCCCTGCGCCGC
CTGTGCGACGAGCGCCGCCTGCTGCTCTTCATGGACGGCGCTCGGCTGGGCGCTGCTCTCACGTCGGCCGTCAAT
GACGTGTCTCTGCCCGACGTGTTGCGTCTGACTGACATTTTCTGGATTGGCGGAACAAAGAATGGCGCCCTGCTG
GGCGAGGCTGTCGTGGTCAAGGACCCGAGCCTGGCCCTCGACTACGACTTTTACGTCAAGCAGCACGGCTCGCTG
CTGGCCAAGAGCCGCGTCATGGGCGTCGAGTTTGCCCAGCTCTTCCGCCACCACCTCTACTTTGACCTGGCCCGC
GACGCCAATGCTGCTGCCGACAAGCTCTCGCGCTCCATTCTCGGCGCTGGCTTTGTCCTGCATGCCGCCACCGAG
ACGAACCAAGTCTTTGCCATTCTGCCCTTGGGCCTCATCAAGATGCTGCAGCACCATTTCCTCTTTTACCTGTGG
GAAAAGCACGATGCCGGCTGGGGCGTTATTCGCCTCCTTACTACCTGGGCCACCGAGCCTGCCCAGGTGGAAAAG
TTTAACAAGATGGTGCTGGCCTGGACGCCCGAGCACAATGGCTTCTGCAACAGCAATGCCTGA
Transcript >OphauB2|2192
ATGCCCAACGCCAGCCTCTCCAACGGCGACTACTGCCCCAAGCCGAGATACAGCTTTCTAGACGACTATGGCGAG
GGCGCACATCCCGAGGTGCTCGAGGCGCTCGTGGCCAGCAACGGCACGCAAGAAGCCGGCTATGGCAAGGATCGC
TACAGCGCCGAGGCTCGAGGGCATATTCGCCGGCACTTGGGCGACGATGCAGGCGACGTGGGCATATTTTTTGTG
CCGGGCGGGACATCGGCCAATGCCATTTCCATTGCGGCCTGTCTGCGGCCTCACGAGGCAGTCATTGCCGCCAGC
TCTGCGCACATTGTGACGCGCGAGACGGGAGCCGTCGAGGCAACGGGCCACAAGATTATCAATGCGCCGCCCGTC
AATGGCAAGCTGACGCCCGACGCCATTATCAAGGCGCTCGACGAGAACTGGCACTACCCGCACATGGCGCGGCCT
CGCCTGGTGTACATTTCCAATGCCACCGAAATTGGCACCGTCTACTCTGCCCACGAGCTGCGCGCCCTGCGCCGC
CTGTGCGACGAGCGCCGCCTGCTGCTCTTCATGGACGGCGCTCGGCTGGGCGCTGCTCTCACGTCGGCCGTCAAT
GACGTGTCTCTGCCCGACGTGTTGCGTCTGACTGACATTTTCTGGATTGGCGGAACAAAGAATGGCGCCCTGCTG
GGCGAGGCTGTCGTGGTCAAGGACCCGAGCCTGGCCCTCGACTACGACTTTTACGTCAAGCAGCACGGCTCGCTG
CTGGCCAAGAGCCGCGTCATGGGCGTCGAGTTTGCCCAGCTCTTCCGCCACCACCTCTACTTTGACCTGGCCCGC
GACGCCAATGCTGCTGCCGACAAGCTCTCGCGCTCCATTCTCGGCGCTGGCTTTGTCCTGCATGCCGCCACCGAG
ACGAACCAAGTCTTTGCCATTCTGCCCTTGGGCCTCATCAAGATGCTGCAGCACCATTTCCTCTTTTACCTGTGG
GAAAAGCACGATGCCGGCTGGGGCGTTATTCGCCTCCTTACTACCTGGGCCACCGAGCCTGCCCAGGTGGAAAAG
TTTAACAAGATGGTGCTGGCCTGGACGCCCGAGCACAATGGCTTCTGCAACAGCAATGCCTGA
Gene >OphauB2|2192
ATGCCCAACGCCAGCCTCTCCAACGGCGACTACTGCCCCAAGCCGAGATACAGCTTTCTAGACGACTATGGCGAG
GGCGCACATCCCGAGGTGCTCGAGGCGCTCGTGGCCAGCAACGGCACGCAAGAAGCCGGCTATGGCAAGGATCGC
TACAGCGCCGAGGCTCGAGGGCATATTCGCCGGCACTTGGGCGACGATGCAGGCGACGTGGGCATATTTTTTGTG
CCGGGCGGGACATCGGCCAATGCCATTTCCATTGCGGCCTGTCTGCGGCCTCACGAGGCAGTCATTGCCGCCAGC
TCTGCGCACATTGTGACGCGCGAGACGGGAGCCGTCGAGGCAACGGGCCACAAGATTATCAATGCGCCGCCCGTC
AATGGCAAGCTGACGCCCGACGCCATTATCAAGGCGCTCGACGAGAACTGGCACTACCCGCACATGGCGCGGCCT
CGCCTGGTGTACATTTCCAATGCCACCGAAATTGGCACCGTCTACTCTGCCCACGAGCTGCGCGCCCTGCGCCGC
CTGTGCGACGAGCGCCGCCTGCTGCTCTTCATGGACGGCGCTCGGCTGGGCGCTGCTCTCACGTCGGCCGTCAAT
GACGTGTCTCTGCCCGACGTGTTGCGTCTGACTGACATTTTCTGGATTGGCGGAACAAAGAATGGCGCCCTGCTG
GGCGAGGCTGTCGTGGTCAAGGACCCGAGCCTGGCCCTCGACTACGACTTTTACGTCAAGCAGCACGGCTCGCTG
CTGGCCAAGAGCCGCGTCATGGGCGTCGAGTTTGCCCAGCTCTTCCGCCACCACCTCTACTTTGACCTGGCCCGC
GACGCCAATGCTGCTGCCGACAAGCTCTCGCGCTCCATTCTCGGCGCTGGCTTTGTCCTGCATGCCGCCACCGAG
ACGAACCAAGTCTTTGCCATTCTGCCCTTGGGCCTCATCAAGATGCTGCAGCACCATTTCCTCTTTTACCTGTGG
GAAAAGCACGATGCCGGCTGGGGCGTTATTCGCCTCCTTACTACCTGGGCCACCGAGCCTGCCCAGGTGGAAAAG
TTTAACAAGATGGTGCTGGCCTGGACGCCCGAGCACAATGGCTTCTGCAACAGCAATGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail