Protein ID | OphauB2|2189 |
Gene name | |
Location | Contig_167:18803..19699 |
Strand | + |
Gene length (bp) | 896 |
Transcript length (bp) | 774 |
Coding sequence length (bp) | 774 |
Protein length (aa) | 258 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF13241 | NAD_binding_7 | Putative NAD(P)-binding | 2.1E-29 | 16 | 127 |
PF14823 | Sirohm_synth_C | Sirohaem biosynthesis protein C-terminal | 1.1E-26 | 160 | 227 |
PF14824 | Sirohm_synth_M | Sirohaem biosynthesis protein central | 6.3E-14 | 131 | 158 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O14172|MET8_SCHPO | Siroheme biosynthesis protein met8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met8 PE=3 SV=1 | 1 | 228 | 3.0E-75 |
sp|P15807|MET8_YEAST | Siroheme biosynthesis protein MET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET8 PE=1 SV=1 | 13 | 201 | 1.0E-22 |
sp|Q6LM67|CYSG_PHOPR | Siroheme synthase OS=Photobacterium profundum GN=cysG PE=3 SV=1 | 20 | 213 | 7.0E-22 |
sp|B8GUD3|CYSG_THISH | Siroheme synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=cysG PE=3 SV=1 | 19 | 202 | 1.0E-20 |
sp|Q1H3L5|CYSG_METFK | Siroheme synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=cysG PE=3 SV=2 | 13 | 165 | 2.0E-20 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O14172|MET8_SCHPO | Siroheme biosynthesis protein met8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met8 PE=3 SV=1 | 1 | 228 | 3.0E-75 |
sp|P15807|MET8_YEAST | Siroheme biosynthesis protein MET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET8 PE=1 SV=1 | 13 | 201 | 1.0E-22 |
sp|Q6LM67|CYSG_PHOPR | Siroheme synthase OS=Photobacterium profundum GN=cysG PE=3 SV=1 | 20 | 213 | 7.0E-22 |
sp|B8GUD3|CYSG_THISH | Siroheme synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=cysG PE=3 SV=1 | 19 | 202 | 1.0E-20 |
sp|Q1H3L5|CYSG_METFK | Siroheme synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=cysG PE=3 SV=2 | 13 | 165 | 2.0E-20 |
sp|Q1LTP4|CYSG_BAUCH | Siroheme synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysG PE=3 SV=1 | 20 | 246 | 7.0E-20 |
sp|O74468|SUMT_SCHPO | Probable uroporphyrinogen-III C-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.06c PE=2 SV=1 | 14 | 214 | 3.0E-19 |
sp|A1AVU5|CYSG_RUTMC | Siroheme synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=cysG PE=3 SV=1 | 20 | 198 | 1.0E-18 |
sp|A5CXE4|CYSG_VESOH | Siroheme synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=cysG PE=3 SV=1 | 20 | 193 | 3.0E-18 |
sp|Q0VQ05|CYSG_ALCBS | Siroheme synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=cysG PE=3 SV=1 | 14 | 193 | 6.0E-18 |
sp|P57500|CYSG_BUCAI | Siroheme synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysG PE=3 SV=1 | 20 | 218 | 2.0E-17 |
sp|A8G9Y3|CYSG1_SERP5 | Siroheme synthase 1 OS=Serratia proteamaculans (strain 568) GN=cysG1 PE=3 SV=1 | 20 | 179 | 2.0E-17 |
sp|A4SHL4|CYSG1_AERS4 | Siroheme synthase 1 OS=Aeromonas salmonicida (strain A449) GN=cysG1 PE=3 SV=1 | 19 | 178 | 3.0E-17 |
sp|A0KLD7|CYSG1_AERHH | Siroheme synthase 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysG1 PE=3 SV=1 | 14 | 193 | 3.0E-17 |
sp|Q5NRM4|CYSG_ZYMMO | Siroheme synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysG PE=3 SV=1 | 20 | 193 | 6.0E-17 |
sp|A5WEG6|CYSG_PSYWF | Siroheme synthase OS=Psychrobacter sp. (strain PRwf-1) GN=cysG PE=3 SV=1 | 16 | 193 | 6.0E-17 |
sp|A8AQS4|CYSG_CITK8 | Siroheme synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysG PE=3 SV=1 | 19 | 179 | 7.0E-17 |
sp|Q6CZS0|CYSG2_PECAS | Siroheme synthase 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysG2 PE=3 SV=1 | 19 | 178 | 8.0E-17 |
sp|Q7N8L2|CYSG_PHOLL | Siroheme synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysG PE=3 SV=1 | 19 | 179 | 9.0E-17 |
sp|Q65T49|CYSG_MANSM | Siroheme synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysG PE=3 SV=2 | 20 | 195 | 1.0E-16 |
sp|A7MJ67|CYSG1_CROS8 | Siroheme synthase 1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysG1 PE=3 SV=1 | 14 | 193 | 2.0E-16 |
sp|Q820Q4|CYSG_NITEU | Siroheme synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysG PE=3 SV=2 | 20 | 208 | 6.0E-16 |
sp|Q4FSU1|CYSG_PSYA2 | Siroheme synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=cysG PE=3 SV=2 | 16 | 193 | 6.0E-16 |
sp|B3GZA0|CYSG_ACTP7 | Siroheme synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cysG PE=3 SV=1 | 20 | 229 | 1.0E-15 |
sp|A0KQJ4|CYSG3_AERHH | Siroheme synthase 3 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysG3 PE=3 SV=1 | 19 | 178 | 1.0E-15 |
sp|Q1QAX7|CYSG_PSYCK | Siroheme synthase OS=Psychrobacter cryohalolentis (strain K5) GN=cysG PE=3 SV=2 | 16 | 193 | 3.0E-15 |
sp|Q8Z201|CYSG_SALTI | Siroheme synthase OS=Salmonella typhi GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-15 |
sp|A4TPZ1|CYSG2_YERPP | Siroheme synthase 2 OS=Yersinia pestis (strain Pestoides F) GN=cysG2 PE=3 SV=1 | 20 | 201 | 3.0E-15 |
sp|Q1CLS2|CYSG1_YERPN | Siroheme synthase 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysG1 PE=3 SV=1 | 20 | 201 | 3.0E-15 |
sp|A7FLY4|CYSG1_YERP3 | Siroheme synthase 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysG1 PE=3 SV=1 | 20 | 201 | 3.0E-15 |
sp|Q66EC9|CYSG1_YERPS | Siroheme synthase 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysG1 PE=3 SV=1 | 20 | 201 | 3.0E-15 |
sp|Q1IBC9|CYSG_PSEE4 | Siroheme synthase OS=Pseudomonas entomophila (strain L48) GN=cysG PE=3 SV=1 | 14 | 193 | 3.0E-15 |
sp|Q2Y6L7|CYSG_NITMU | Siroheme synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=cysG PE=3 SV=2 | 20 | 197 | 5.0E-15 |
sp|A1WYD5|CYSG2_HALHL | Siroheme synthase 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=cysG2 PE=3 SV=1 | 20 | 219 | 6.0E-15 |
sp|A4WFH1|CYSG_ENT38 | Siroheme synthase OS=Enterobacter sp. (strain 638) GN=cysG PE=3 SV=1 | 19 | 193 | 6.0E-15 |
sp|Q6D1A4|CYSG1_PECAS | Siroheme synthase 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysG1 PE=3 SV=1 | 20 | 197 | 7.0E-15 |
sp|Q493N1|CYSG_BLOPB | Siroheme synthase OS=Blochmannia pennsylvanicus (strain BPEN) GN=cysG PE=3 SV=1 | 20 | 193 | 7.0E-15 |
sp|A9MME5|CYSG_SALAR | Siroheme synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysG PE=3 SV=1 | 19 | 246 | 9.0E-15 |
sp|B4TY38|CYSG_SALSV | Siroheme synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=cysG PE=3 SV=1 | 19 | 246 | 1.0E-14 |
sp|B5BH22|CYSG_SALPK | Siroheme synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=cysG PE=3 SV=1 | 19 | 246 | 1.0E-14 |
sp|Q5PLV8|CYSG_SALPA | Siroheme synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysG PE=3 SV=1 | 19 | 246 | 1.0E-14 |
sp|Q7WB57|CYSG_BORPA | Siroheme synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysG PE=3 SV=1 | 20 | 194 | 1.0E-14 |
sp|Q7WMM4|CYSG_BORBR | Siroheme synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysG PE=3 SV=1 | 20 | 194 | 1.0E-14 |
sp|Q7VZ77|CYSG_BORPE | Siroheme synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysG PE=3 SV=1 | 20 | 194 | 1.0E-14 |
sp|C3JY53|CYSG_PSEFS | Siroheme synthase OS=Pseudomonas fluorescens (strain SBW25) GN=cysG PE=3 SV=1 | 14 | 193 | 1.0E-14 |
sp|Q0AHC1|CYSG_NITEC | Siroheme synthase OS=Nitrosomonas eutropha (strain C91) GN=cysG PE=3 SV=1 | 20 | 179 | 1.0E-14 |
sp|Q3ILQ9|CYSG_PSEHT | Siroheme synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cysG PE=3 SV=1 | 19 | 193 | 1.0E-14 |
sp|Q606C9|CYSG_METCA | Siroheme synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysG PE=3 SV=1 | 19 | 219 | 2.0E-14 |
sp|A1WWP8|CYSG1_HALHL | Siroheme synthase 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=cysG1 PE=3 SV=1 | 24 | 219 | 2.0E-14 |
sp|Q2NVN0|CYSG_SODGM | Siroheme synthase OS=Sodalis glossinidius (strain morsitans) GN=cysG PE=3 SV=1 | 20 | 179 | 2.0E-14 |
sp|C1DKY7|CYSG_AZOVD | Siroheme synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=cysG PE=3 SV=1 | 14 | 193 | 3.0E-14 |
sp|A4SRH0|CYSG2_AERS4 | Siroheme synthase 2 OS=Aeromonas salmonicida (strain A449) GN=cysG2 PE=3 SV=2 | 19 | 216 | 3.0E-14 |
sp|B4SVI1|CYSG_SALNS | Siroheme synthase OS=Salmonella newport (strain SL254) GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-14 |
sp|Q15YU1|CYSG_PSEA6 | Siroheme synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cysG PE=3 SV=1 | 21 | 208 | 3.0E-14 |
sp|P25924|CYSG_SALTY | Siroheme synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysG PE=1 SV=1 | 19 | 246 | 3.0E-14 |
sp|B5F8J0|CYSG_SALA4 | Siroheme synthase OS=Salmonella agona (strain SL483) GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-14 |
sp|C0Q0F3|CYSG_SALPC | Siroheme synthase OS=Salmonella paratyphi C (strain RKS4594) GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-14 |
sp|A9MT45|CYSG_SALPB | Siroheme synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-14 |
sp|B5R7N6|CYSG_SALG2 | Siroheme synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-14 |
sp|B5R2C7|CYSG_SALEP | Siroheme synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-14 |
sp|Q57IZ5|CYSG_SALCH | Siroheme synthase OS=Salmonella choleraesuis (strain SC-B67) GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-14 |
sp|A9HZV6|CYSG_BORPD | Siroheme synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=cysG PE=3 SV=1 | 20 | 194 | 3.0E-14 |
sp|Q664M6|CYSG2_YERPS | Siroheme synthase 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysG2 PE=3 SV=1 | 19 | 179 | 3.0E-14 |
sp|A7FNS9|CYSG2_YERP3 | Siroheme synthase 2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysG2 PE=3 SV=1 | 19 | 179 | 3.0E-14 |
sp|A1JSB7|CYSG2_YERE8 | Siroheme synthase 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysG2 PE=3 SV=1 | 19 | 213 | 3.0E-14 |
sp|A6TD45|CYSG1_KLEP7 | Siroheme synthase 1 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysG1 PE=3 SV=2 | 14 | 197 | 3.0E-14 |
sp|Q0A812|CYSG_ALKEH | Siroheme synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=cysG PE=3 SV=1 | 13 | 197 | 4.0E-14 |
sp|A0KP37|CYSG2_AERHH | Siroheme synthase 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysG2 PE=3 SV=1 | 25 | 216 | 4.0E-14 |
sp|B4TKQ4|CYSG_SALHS | Siroheme synthase OS=Salmonella heidelberg (strain SL476) GN=cysG PE=3 SV=1 | 19 | 246 | 4.0E-14 |
sp|A6TF07|CYSG2_KLEP7 | Siroheme synthase 2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysG2 PE=3 SV=2 | 19 | 246 | 5.0E-14 |
sp|B5FJQ1|CYSG_SALDC | Siroheme synthase OS=Salmonella dublin (strain CT_02021853) GN=cysG PE=3 SV=1 | 19 | 246 | 6.0E-14 |
sp|A4TGU8|CYSG1_YERPP | Siroheme synthase 1 OS=Yersinia pestis (strain Pestoides F) GN=cysG1 PE=3 SV=1 | 19 | 179 | 6.0E-14 |
sp|Q48H75|CYSG_PSE14 | Siroheme synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=cysG PE=3 SV=1 | 14 | 193 | 6.0E-14 |
sp|Q31GG8|CYSG_THICR | Siroheme synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=cysG PE=3 SV=1 | 19 | 201 | 6.0E-14 |
sp|A9LZ77|CYSG_NEIM0 | Siroheme synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=cysG PE=3 SV=1 | 25 | 180 | 6.0E-14 |
sp|B6I2S7|CYSG_ECOSE | Siroheme synthase OS=Escherichia coli (strain SE11) GN=cysG PE=3 SV=1 | 19 | 246 | 9.0E-14 |
sp|B7M1S1|CYSG_ECO8A | Siroheme synthase OS=Escherichia coli O8 (strain IAI1) GN=cysG PE=3 SV=1 | 19 | 246 | 9.0E-14 |
sp|A7ZSP4|CYSG_ECO24 | Siroheme synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysG PE=3 SV=1 | 19 | 246 | 9.0E-14 |
sp|Q87ZT0|CYSG_PSESM | Siroheme synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysG PE=3 SV=1 | 14 | 193 | 1.0E-13 |
sp|Q4ZRL6|CYSG_PSEU2 | Siroheme synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cysG PE=3 SV=1 | 14 | 193 | 1.0E-13 |
sp|Q1R5R3|CYSG_ECOUT | Siroheme synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=cysG PE=3 SV=1 | 19 | 246 | 1.0E-13 |
sp|Q0TC92|CYSG_ECOL5 | Siroheme synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysG PE=3 SV=1 | 19 | 246 | 1.0E-13 |
sp|A1AGQ2|CYSG_ECOK1 | Siroheme synthase OS=Escherichia coli O1:K1 / APEC GN=cysG PE=3 SV=1 | 19 | 246 | 1.0E-13 |
sp|B7MCY5|CYSG_ECO45 | Siroheme synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysG PE=3 SV=1 | 19 | 246 | 1.0E-13 |
sp|B7NMD7|CYSG_ECO7I | Siroheme synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysG PE=3 SV=1 | 19 | 246 | 1.0E-13 |
sp|B7LS75|CYSG_ESCF3 | Siroheme synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysG PE=3 SV=1 | 19 | 246 | 1.0E-13 |
sp|B0BTC2|CYSG_ACTPJ | Siroheme synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cysG PE=3 SV=1 | 20 | 229 | 2.0E-13 |
sp|Q32AZ8|CYSG_SHIDS | Siroheme synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|Q8FCW8|CYSG_ECOL6 | Siroheme synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|B7UK79|CYSG_ECO27 | Siroheme synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|Q02NA3|CYSG_PSEAB | Siroheme synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysG PE=3 SV=1 | 14 | 224 | 2.0E-13 |
sp|B1LHG9|CYSG_ECOSM | Siroheme synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|P0AEA8|CYSG_ECOLI | Siroheme synthase OS=Escherichia coli (strain K12) GN=cysG PE=1 SV=1 | 19 | 246 | 2.0E-13 |
sp|B1IP96|CYSG_ECOLC | Siroheme synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|A8A5H5|CYSG_ECOHS | Siroheme synthase OS=Escherichia coli O9:H4 (strain HS) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|B1X716|CYSG_ECODH | Siroheme synthase OS=Escherichia coli (strain K12 / DH10B) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|C4ZUM4|CYSG_ECOBW | Siroheme synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|P0AEA9|CYSG_ECO57 | Siroheme synthase OS=Escherichia coli O157:H7 GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|B7L4P2|CYSG_ECO55 | Siroheme synthase OS=Escherichia coli (strain 55989 / EAEC) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|B7N1F1|CYSG_ECO81 | Siroheme synthase OS=Escherichia coli O81 (strain ED1a) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|Q9I0M7|CYSG_PSEAE | Siroheme synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysG PE=3 SV=1 | 14 | 224 | 2.0E-13 |
sp|A1JJS8|CYSG1_YERE8 | Siroheme synthase 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysG1 PE=3 SV=1 | 20 | 201 | 2.0E-13 |
sp|Q31VS0|CYSG_SHIBS | Siroheme synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|B2U3H4|CYSG_SHIB3 | Siroheme synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysG PE=3 SV=1 | 19 | 246 | 2.0E-13 |
sp|A6V4H6|CYSG_PSEA7 | Siroheme synthase OS=Pseudomonas aeruginosa (strain PA7) GN=cysG PE=3 SV=1 | 14 | 224 | 2.0E-13 |
sp|Q3YWQ3|CYSG_SHISS | Siroheme synthase OS=Shigella sonnei (strain Ss046) GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-13 |
sp|Q83JB3|CYSG_SHIFL | Siroheme synthase OS=Shigella flexneri GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-13 |
sp|Q0SZU8|CYSG_SHIF8 | Siroheme synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=cysG PE=3 SV=1 | 19 | 246 | 3.0E-13 |
sp|B7UW11|CYSG_PSEA8 | Siroheme synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysG PE=3 SV=1 | 14 | 224 | 3.0E-13 |
sp|A7MKK9|CYSG2_CROS8 | Siroheme synthase 2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysG2 PE=3 SV=1 | 19 | 193 | 3.0E-13 |
sp|B5YTS6|CYSG_ECO5E | Siroheme synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysG PE=3 SV=1 | 19 | 246 | 4.0E-13 |
sp|Q3JCS0|CYSG_NITOC | Siroheme synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cysG PE=3 SV=1 | 20 | 193 | 4.0E-13 |
sp|Q4K9V8|CYSG_PSEF5 | Siroheme synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cysG PE=3 SV=1 | 14 | 193 | 7.0E-13 |
sp|Q74Y23|CYSG_YERPE | Siroheme synthase OS=Yersinia pestis GN=cysG PE=3 SV=1 | 19 | 179 | 8.0E-13 |
sp|Q1C2P9|CYSG_YERPA | Siroheme synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysG PE=3 SV=1 | 19 | 179 | 8.0E-13 |
sp|Q1CCP6|CYSG2_YERPN | Siroheme synthase 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysG2 PE=3 SV=1 | 19 | 179 | 8.0E-13 |
sp|B7NDX8|CYSG_ECOLU | Siroheme synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysG PE=3 SV=1 | 19 | 246 | 9.0E-13 |
sp|Q3KA85|CYSG_PSEPF | Siroheme synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=cysG PE=3 SV=1 | 14 | 193 | 2.0E-12 |
sp|C5BGP8|CYSG_EDWI9 | Siroheme synthase OS=Edwardsiella ictaluri (strain 93-146) GN=cysG PE=3 SV=1 | 19 | 247 | 2.0E-12 |
sp|Q3SG32|CYSG_THIDA | Siroheme synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=cysG PE=3 SV=1 | 20 | 193 | 3.0E-12 |
sp|Q59292|HEMA_CLOJO | Probable multifunctional siroheme biosynthesis protein HemA OS=Clostridium josui GN=hemA PE=3 SV=1 | 12 | 151 | 3.0E-12 |
sp|Q7VQG9|CYSG_BLOFL | Siroheme synthase OS=Blochmannia floridanus GN=cysG PE=3 SV=1 | 20 | 193 | 5.0E-12 |
sp|C4LAG5|CYSG_TOLAT | Siroheme synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysG PE=3 SV=1 | 19 | 196 | 9.0E-12 |
sp|Q6F8G6|CYSG_ACIAD | Siroheme synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysG PE=3 SV=1 | 16 | 225 | 9.0E-12 |
sp|A4XUX3|CYSG_PSEMY | Siroheme synthase OS=Pseudomonas mendocina (strain ymp) GN=cysG PE=3 SV=1 | 14 | 193 | 1.0E-11 |
sp|Q2KWB0|CYSG_BORA1 | Siroheme synthase OS=Bordetella avium (strain 197N) GN=cysG PE=3 SV=2 | 20 | 194 | 2.0E-11 |
sp|Q7NZV7|CYSG_CHRVO | Siroheme synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysG PE=3 SV=1 | 19 | 193 | 3.0E-11 |
sp|A8GKQ1|CYSG2_SERP5 | Siroheme synthase 2 OS=Serratia proteamaculans (strain 568) GN=cysG2 PE=3 SV=1 | 19 | 246 | 4.0E-11 |
sp|A4VLU6|CYSG_PSEU5 | Siroheme synthase OS=Pseudomonas stutzeri (strain A1501) GN=cysG PE=3 SV=2 | 14 | 193 | 4.0E-11 |
sp|Q21K21|CYSG_SACD2 | Siroheme synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysG PE=3 SV=1 | 14 | 208 | 2.0E-10 |
sp|Q5FP95|CYSG_GLUOX | Siroheme synthase OS=Gluconobacter oxydans (strain 621H) GN=cysG PE=3 SV=1 | 9 | 208 | 2.0E-10 |
sp|A1SRP9|CYSG_PSYIN | Siroheme synthase OS=Psychromonas ingrahamii (strain 37) GN=cysG PE=3 SV=1 | 19 | 225 | 2.0E-09 |
sp|A6VPZ6|CYSG_ACTSZ | Siroheme synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cysG PE=3 SV=1 | 35 | 195 | 2.0E-09 |
sp|A1KU10|CYSG_NEIMF | Siroheme synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cysG PE=3 SV=1 | 25 | 201 | 3.0E-09 |
sp|P57001|CYSG_NEIMA | Siroheme synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysG PE=3 SV=1 | 25 | 201 | 4.0E-09 |
sp|P95370|CYSG_NEIMB | Siroheme synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysG PE=3 SV=3 | 25 | 201 | 4.0E-09 |
sp|A5W1H7|CYSG_PSEP1 | Siroheme synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cysG PE=3 SV=1 | 75 | 193 | 3.0E-08 |
sp|Q88FT3|CYSG_PSEPK | Siroheme synthase OS=Pseudomonas putida (strain KT2440) GN=cysG PE=3 SV=1 | 75 | 193 | 4.0E-08 |
sp|B1JBD9|CYSG_PSEPW | Siroheme synthase OS=Pseudomonas putida (strain W619) GN=cysG PE=3 SV=1 | 42 | 195 | 5.0E-08 |
sp|P61818|SIRC_BACME | Precorrin-2 dehydrogenase OS=Bacillus megaterium GN=sirC PE=1 SV=1 | 20 | 202 | 2.0E-07 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 11 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauB2|2189 MAQLFPEVQPGGSLILAWQIKDKRVIVVGGGEVAAGRILNCLNADAKVTVLCPASGLNDEVAYRVSQNQVSHVDR LFEPSDLDGADMVLVAVDDPAASTAIWKLCKERKIAANIADVPSECDFYFGSVYRDGPLQVMVSTNGKGPRLAAS IRRFIAAQLPKNAGNAIESIGELRAKLRKVAPNVDDSPKRMRWMSKVSDAYRWEDMCNFTNEDMDNLLLFYPAEK VPSIDILLALRGGTDVKKLDVFDGSFGFSVGA* |
Coding | >OphauB2|2189 ATGGCTCAGCTGTTTCCCGAGGTGCAGCCCGGCGGCAGCCTGATCCTCGCATGGCAGATCAAGGACAAGCGAGTC ATTGTTGTTGGAGGCGGTGAAGTCGCCGCCGGCCGCATCCTCAACTGCCTCAACGCCGATGCCAAAGTCACTGTG CTATGTCCAGCCTCGGGACTCAACGACGAGGTCGCATACCGCGTATCGCAGAACCAAGTCAGCCATGTAGACCGG CTCTTTGAGCCGTCAGATCTCGACGGCGCCGACATGGTGCTGGTGGCTGTCGACGACCCAGCCGCCTCAACCGCC ATTTGGAAGCTGTGCAAGGAGCGCAAGATTGCTGCAAATATCGCAGACGTGCCGTCCGAGTGTGACTTTTACTTT GGCAGCGTCTATCGGGACGGACCGCTGCAAGTCATGGTCAGCACAAACGGCAAGGGCCCCAGGCTGGCAGCTTCG ATACGACGCTTCATCGCGGCACAGCTGCCGAAAAATGCGGGAAACGCCATAGAGTCGATTGGCGAGCTGAGGGCC AAGCTGCGCAAGGTGGCGCCCAATGTCGACGACAGCCCCAAGCGGATGCGCTGGATGTCCAAGGTTAGCGACGCC TACAGATGGGAGGATATGTGCAATTTCACCAATGAGGACATGGACAATCTCCTGCTCTTTTACCCGGCTGAAAAG GTGCCTTCAATCGATATTCTCCTTGCTCTTCGCGGCGGCACCGATGTCAAGAAGCTTGATGTTTTTGACGGCTCG TTTGGATTCAGCGTAGGTGCATAA |
Transcript | >OphauB2|2189 ATGGCTCAGCTGTTTCCCGAGGTGCAGCCCGGCGGCAGCCTGATCCTCGCATGGCAGATCAAGGACAAGCGAGTC ATTGTTGTTGGAGGCGGTGAAGTCGCCGCCGGCCGCATCCTCAACTGCCTCAACGCCGATGCCAAAGTCACTGTG CTATGTCCAGCCTCGGGACTCAACGACGAGGTCGCATACCGCGTATCGCAGAACCAAGTCAGCCATGTAGACCGG CTCTTTGAGCCGTCAGATCTCGACGGCGCCGACATGGTGCTGGTGGCTGTCGACGACCCAGCCGCCTCAACCGCC ATTTGGAAGCTGTGCAAGGAGCGCAAGATTGCTGCAAATATCGCAGACGTGCCGTCCGAGTGTGACTTTTACTTT GGCAGCGTCTATCGGGACGGACCGCTGCAAGTCATGGTCAGCACAAACGGCAAGGGCCCCAGGCTGGCAGCTTCG ATACGACGCTTCATCGCGGCACAGCTGCCGAAAAATGCGGGAAACGCCATAGAGTCGATTGGCGAGCTGAGGGCC AAGCTGCGCAAGGTGGCGCCCAATGTCGACGACAGCCCCAAGCGGATGCGCTGGATGTCCAAGGTTAGCGACGCC TACAGATGGGAGGATATGTGCAATTTCACCAATGAGGACATGGACAATCTCCTGCTCTTTTACCCGGCTGAAAAG GTGCCTTCAATCGATATTCTCCTTGCTCTTCGCGGCGGCACCGATGTCAAGAAGCTTGATGTTTTTGACGGCTCG TTTGGATTCAGCGTAGGTGCATAA |
Gene | >OphauB2|2189 ATGGCTCAGCTGTTTCCCGAGGTGCAGCCCGGCGGCAGCCTGATCCTCGCATGGCAGATCAAGGACAAGCGAGTC ATTGTTGTTGGAGGCGGTGAAGTGTGTCGATGCAACGATGCACTCGTGATGATTGCAAAGCTAACCACAACTTAC AGGTCGCCGCCGGCCGCATCCTCAACTGCCTCAACGCCGATGCCAAAGTCACTGTGCTATGTCCAGCCTCGGGAC TCAACGACGAGGTCGCATACCGCGTATCGCAGAACCAAGTCAGCCATGTAGACCGGCTCTTTGAGCCGTCAGATC TCGACGGCGCCGACATGGTGCTGGTGGCTGTCGACGACCCAGCCGCCTCAACCGCCATTTGGAAGCTGTGCAAGG AGCGCAAGATTGCTGCAAATATCGCAGACGTGCCGTCCGAGTGTGACTTTTACTTTGGCAGCGTCTATCGGGACG GACCGCTGCAAGTCATGGTCAGCACAAACGGCAAGGGCCCCAGGCTGGCAGCTTCGATACGACGCTTCATCGCGG CACAGCTGCCGAAAAATGCGGGAAACGCCATAGAGTCGATTGGCGAGCTGAGGGCCAAGCTGCGCAAGGTGGCGC CCAATGTCGACGACAGCCCCAAGCGGATGCGCTGGTCAGTTGCAAGGCAGGGTAATATGTGGTACTTTTCCAAGA CACTGACATGGTTGGCCGTTGCTAGGATGTCCAAGGTTAGCGACGCCTACAGATGGGAGGATATGTGCAATTTCA CCAATGAGGACATGGACAATCTCCTGCTCTTTTACCCGGCTGAAAAGGTGCCTTCAATCGATATTCTCCTTGCTC TTCGCGGCGGCACCGATGTCAAGAAGCTTGATGTTTTTGACGGCTCGTTTGGATTCAGCGTAGGTGCATAA |