Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2187
Gene name
LocationContig_167:12833..15422
Strand+
Gene length (bp)2589
Transcript length (bp)2472
Coding sequence length (bp)2472
Protein length (aa) 824

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13637 Ank_4 Ankyrin repeats (many copies) 4.6E-08 397 438
PF04383 KilA-N KilA-N domain 4.2E-04 62 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P01129|CDC10_SCHPO Start control protein cdc10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc10 PE=1 SV=1 44 815 9.0E-85
sp|P09959|SWI6_YEAST Regulatory protein SWI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI6 PE=1 SV=1 384 815 1.0E-57
sp|P40418|SWI6_KLULA Regulatory protein SWI6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWI6 PE=3 SV=1 384 815 3.0E-49
sp|P41412|RES2_SCHPO Cell division cycle-related protein res2/pct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res2 PE=1 SV=1 43 150 3.0E-34
sp|P33520|RES1_SCHPO Cell division cycle-related protein res1/sct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res1 PE=1 SV=1 44 141 8.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P01129|CDC10_SCHPO Start control protein cdc10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc10 PE=1 SV=1 44 815 9.0E-85
sp|P09959|SWI6_YEAST Regulatory protein SWI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI6 PE=1 SV=1 384 815 1.0E-57
sp|P40418|SWI6_KLULA Regulatory protein SWI6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWI6 PE=3 SV=1 384 815 3.0E-49
sp|P41412|RES2_SCHPO Cell division cycle-related protein res2/pct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res2 PE=1 SV=1 43 150 3.0E-34
sp|P33520|RES1_SCHPO Cell division cycle-related protein res1/sct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res1 PE=1 SV=1 44 141 8.0E-31
sp|P39678|MBP1_YEAST Transcription factor MBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBP1 PE=1 SV=1 44 151 8.0E-26
sp|P41412|RES2_SCHPO Cell division cycle-related protein res2/pct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res2 PE=1 SV=1 351 685 4.0E-25
sp|P33520|RES1_SCHPO Cell division cycle-related protein res1/sct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res1 PE=1 SV=1 360 589 2.0E-23
sp|P39678|MBP1_YEAST Transcription factor MBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBP1 PE=1 SV=1 349 618 2.0E-23
sp|P25302|SWI4_YEAST Regulatory protein SWI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI4 PE=1 SV=2 47 141 1.0E-21
sp|P39679|MBP1_KLULA Transcription factor MBP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MBP1 PE=3 SV=2 388 803 2.0E-20
sp|Q59P39|EFH1_CANAL Transcriptional regulator EFH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFH1 PE=2 SV=1 53 185 2.0E-10
sp|P36011|STUA_EMENI Cell pattern formation-associated protein stuA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stuA PE=2 SV=2 51 139 3.0E-10
sp|P25302|SWI4_YEAST Regulatory protein SWI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI4 PE=1 SV=2 351 573 1.0E-09
sp|P53438|SOK2_YEAST Protein SOK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOK2 PE=1 SV=1 54 143 1.0E-08
sp|P36093|PHD1_YEAST Putative transcription factor PHD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHD1 PE=1 SV=1 54 143 3.0E-08
sp|Q59X67|EFG1_CANAL Enhanced filamentous growth protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFG1 PE=1 SV=1 54 143 8.0E-08
sp|P43064|EFG1_CANAX Enhanced filamentous growth protein OS=Candida albicans GN=EFG1 PE=3 SV=1 54 143 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2187
MASKMPSASQASQQSFSMSQSQSQPRPSVPFQHGSNKAASIEGIYSSSYSGIDLYEMEVNGVVVMRRRHDSWLNA
TQILKVAGLDKGKRTKILEKEIQTGEHEKVQGGYGKYQGTWIAFDRGVEVCRQYGVEDLLRPLLTYDMGQDGGVA
GRGDFNTPTKEQAMAAQRKRMYNANASADSRANGLSGTFFKNISTTASHAVAAISKARFDSPGPRNRNGPSRPPS
FSRQPSIQKNSENHMPNSTQQSFASEYAQQQTDTSSYQTQPPNGSAGTMHDNEPPRKRQRVTMTPADSYGSYNQH
VADVYPNAGPVGSPTEPNDSFIYNSQAAANDVPQAEEGYGTLPPLPPAETADIEEKRSMLIRLFMDPGSSTSDPS
TYSMLHSYTPAELDMPIDPQSHTALHWAATLARMPLLRALIAAGASPWRVNASGETALMRACLVTNSMDHGSFPD
LLDVLGGTIEARDNKGRTVLHHISVTSAVKGRSAASRYYLESLLEWVVRQGSAPNSQPEQANGTFSGTMSTMAPK
MGIARFMSEIVNAQDASGDTALNIASRIGNRSIISQLLEVSADPEIANRVGLRPSDFGIGKDESDGRISGQAAEE
VNGVSGISQRSSDKNDDIMTSITRLLEDTGASFQQELKDKQASLDTLHATLRSTSGQLGEAKKTVESLMATLKKQ
QLARQKIANLAHAREDDQIRINEQSAASQPSSSWETELVAMLEAVDASAAEGQVGSRGMLPPPAVLRARIRAIEG
RRDYMRKMVHALKGRSREVEVKYRRVVALCTGVQDSDVDAMVDGLLKAVRSEGEELDIGRVRRFLGGIDGPVD*
Coding >OphauB2|2187
ATGGCATCCAAGATGCCGTCGGCGTCACAGGCGTCTCAGCAGTCGTTTAGCATGAGCCAGTCACAGTCACAGCCG
CGTCCTTCGGTGCCCTTTCAGCACGGCTCTAACAAGGCAGCGTCTATTGAGGGCATATATTCGTCGTCGTATTCC
GGCATCGACCTCTACGAGATGGAAGTCAATGGCGTTGTTGTGATGCGCCGTCGTCACGACTCGTGGCTCAATGCA
ACTCAGATCCTAAAGGTGGCTGGCCTCGACAAGGGCAAGAGAACAAAAATCCTGGAAAAGGAGATCCAAACTGGC
GAGCACGAAAAAGTCCAGGGGGGCTACGGCAAGTACCAGGGCACCTGGATTGCCTTTGACCGTGGCGTCGAAGTC
TGCCGTCAGTACGGCGTTGAGGATCTGCTGCGCCCGCTGCTCACCTACGACATGGGCCAGGACGGCGGAGTGGCT
GGCAGAGGCGACTTCAACACTCCTACTAAAGAACAAGCCATGGCTGCTCAGCGGAAACGCATGTACAATGCCAAT
GCGAGTGCCGACTCAAGAGCAAATGGCCTGTCGGGCACATTTTTCAAAAACATTTCCACCACTGCGTCTCACGCT
GTCGCTGCTATTAGCAAAGCCCGCTTTGACTCACCTGGTCCAAGAAATCGCAACGGCCCCTCTCGCCCGCCTAGC
TTCAGTCGCCAGCCGTCTATTCAAAAAAACAGCGAAAATCATATGCCCAATAGTACACAGCAAAGTTTTGCATCT
GAATACGCTCAACAGCAGACAGATACCAGTAGCTATCAGACCCAGCCACCGAATGGCAGCGCAGGCACAATGCAC
GACAACGAGCCCCCTCGCAAGAGACAGCGAGTCACAATGACGCCTGCTGACAGCTATGGCAGCTACAACCAGCAT
GTAGCTGATGTGTACCCCAACGCTGGCCCTGTCGGCTCTCCCACGGAGCCCAACGACTCCTTCATTTATAACAGC
CAAGCTGCCGCCAATGACGTTCCCCAGGCCGAAGAAGGCTATGGCACACTGCCTCCTCTGCCTCCTGCCGAGACG
GCCGATATAGAAGAGAAGCGAAGTATGCTGATACGTCTCTTCATGGATCCAGGGTCCTCGACCTCGGATCCGTCC
ACGTACAGCATGCTTCACTCCTATACGCCCGCCGAGCTGGACATGCCTATAGATCCACAAAGCCACACGGCGCTT
CACTGGGCTGCAACTCTGGCCCGCATGCCTCTTCTTCGCGCTCTCATCGCAGCTGGAGCTTCTCCATGGCGTGTC
AATGCTTCGGGGGAGACGGCACTCATGCGAGCTTGTCTTGTGACCAACTCGATGGACCACGGATCCTTTCCCGAT
CTGCTTGACGTTCTCGGAGGCACAATTGAAGCACGGGACAACAAGGGGCGGACTGTGCTGCATCACATTTCAGTC
ACTTCGGCGGTCAAAGGTCGCAGTGCAGCCAGTCGTTACTACCTCGAGAGTCTGCTTGAATGGGTTGTTCGACAG
GGCAGTGCTCCAAACAGCCAGCCTGAACAGGCAAATGGAACTTTTTCCGGCACCATGTCGACGATGGCTCCTAAG
ATGGGCATCGCGCGCTTCATGTCGGAAATTGTCAATGCCCAGGATGCTTCGGGCGATACCGCCCTCAATATTGCT
TCGAGGATCGGCAACCGCAGCATCATTTCTCAGCTGCTGGAAGTAAGCGCTGATCCCGAGATTGCCAACCGCGTT
GGCCTCCGACCTTCAGATTTCGGCATAGGCAAGGACGAAAGCGACGGTCGCATCAGTGGCCAGGCTGCGGAAGAG
GTCAATGGCGTCTCAGGCATTAGCCAGCGTTCTAGCGACAAGAATGACGATATTATGACGTCAATCACGCGCCTC
CTGGAAGATACTGGCGCGAGCTTCCAGCAAGAGCTCAAGGACAAGCAAGCCTCTCTGGACACTCTTCATGCCACA
CTCAGATCAACGTCTGGCCAATTGGGCGAAGCTAAAAAGACGGTGGAAAGCCTGATGGCGACGCTCAAGAAGCAG
CAGCTGGCGCGACAAAAAATAGCCAACCTGGCCCACGCGCGCGAAGACGACCAGATTCGCATTAATGAGCAATCT
GCCGCCTCCCAGCCGAGTTCGTCCTGGGAGACTGAGCTCGTTGCCATGCTCGAGGCTGTTGATGCATCGGCAGCC
GAAGGGCAAGTGGGCAGTCGAGGCATGCTGCCGCCGCCCGCGGTGCTGCGAGCCCGCATCCGCGCCATTGAGGGC
CGGCGCGACTATATGCGCAAAATGGTGCATGCGCTCAAGGGCCGGAGCCGCGAGGTCGAAGTTAAGTACCGCCGC
GTCGTTGCCCTGTGCACCGGCGTGCAGGACAGCGATGTGGATGCCATGGTGGACGGCCTGCTCAAGGCTGTGCGC
AGCGAGGGAGAGGAGCTTGATATCGGGAGGGTAAGGCGCTTTCTCGGTGGCATTGATGGCCCGGTCGACTAG
Transcript >OphauB2|2187
ATGGCATCCAAGATGCCGTCGGCGTCACAGGCGTCTCAGCAGTCGTTTAGCATGAGCCAGTCACAGTCACAGCCG
CGTCCTTCGGTGCCCTTTCAGCACGGCTCTAACAAGGCAGCGTCTATTGAGGGCATATATTCGTCGTCGTATTCC
GGCATCGACCTCTACGAGATGGAAGTCAATGGCGTTGTTGTGATGCGCCGTCGTCACGACTCGTGGCTCAATGCA
ACTCAGATCCTAAAGGTGGCTGGCCTCGACAAGGGCAAGAGAACAAAAATCCTGGAAAAGGAGATCCAAACTGGC
GAGCACGAAAAAGTCCAGGGGGGCTACGGCAAGTACCAGGGCACCTGGATTGCCTTTGACCGTGGCGTCGAAGTC
TGCCGTCAGTACGGCGTTGAGGATCTGCTGCGCCCGCTGCTCACCTACGACATGGGCCAGGACGGCGGAGTGGCT
GGCAGAGGCGACTTCAACACTCCTACTAAAGAACAAGCCATGGCTGCTCAGCGGAAACGCATGTACAATGCCAAT
GCGAGTGCCGACTCAAGAGCAAATGGCCTGTCGGGCACATTTTTCAAAAACATTTCCACCACTGCGTCTCACGCT
GTCGCTGCTATTAGCAAAGCCCGCTTTGACTCACCTGGTCCAAGAAATCGCAACGGCCCCTCTCGCCCGCCTAGC
TTCAGTCGCCAGCCGTCTATTCAAAAAAACAGCGAAAATCATATGCCCAATAGTACACAGCAAAGTTTTGCATCT
GAATACGCTCAACAGCAGACAGATACCAGTAGCTATCAGACCCAGCCACCGAATGGCAGCGCAGGCACAATGCAC
GACAACGAGCCCCCTCGCAAGAGACAGCGAGTCACAATGACGCCTGCTGACAGCTATGGCAGCTACAACCAGCAT
GTAGCTGATGTGTACCCCAACGCTGGCCCTGTCGGCTCTCCCACGGAGCCCAACGACTCCTTCATTTATAACAGC
CAAGCTGCCGCCAATGACGTTCCCCAGGCCGAAGAAGGCTATGGCACACTGCCTCCTCTGCCTCCTGCCGAGACG
GCCGATATAGAAGAGAAGCGAAGTATGCTGATACGTCTCTTCATGGATCCAGGGTCCTCGACCTCGGATCCGTCC
ACGTACAGCATGCTTCACTCCTATACGCCCGCCGAGCTGGACATGCCTATAGATCCACAAAGCCACACGGCGCTT
CACTGGGCTGCAACTCTGGCCCGCATGCCTCTTCTTCGCGCTCTCATCGCAGCTGGAGCTTCTCCATGGCGTGTC
AATGCTTCGGGGGAGACGGCACTCATGCGAGCTTGTCTTGTGACCAACTCGATGGACCACGGATCCTTTCCCGAT
CTGCTTGACGTTCTCGGAGGCACAATTGAAGCACGGGACAACAAGGGGCGGACTGTGCTGCATCACATTTCAGTC
ACTTCGGCGGTCAAAGGTCGCAGTGCAGCCAGTCGTTACTACCTCGAGAGTCTGCTTGAATGGGTTGTTCGACAG
GGCAGTGCTCCAAACAGCCAGCCTGAACAGGCAAATGGAACTTTTTCCGGCACCATGTCGACGATGGCTCCTAAG
ATGGGCATCGCGCGCTTCATGTCGGAAATTGTCAATGCCCAGGATGCTTCGGGCGATACCGCCCTCAATATTGCT
TCGAGGATCGGCAACCGCAGCATCATTTCTCAGCTGCTGGAAGTAAGCGCTGATCCCGAGATTGCCAACCGCGTT
GGCCTCCGACCTTCAGATTTCGGCATAGGCAAGGACGAAAGCGACGGTCGCATCAGTGGCCAGGCTGCGGAAGAG
GTCAATGGCGTCTCAGGCATTAGCCAGCGTTCTAGCGACAAGAATGACGATATTATGACGTCAATCACGCGCCTC
CTGGAAGATACTGGCGCGAGCTTCCAGCAAGAGCTCAAGGACAAGCAAGCCTCTCTGGACACTCTTCATGCCACA
CTCAGATCAACGTCTGGCCAATTGGGCGAAGCTAAAAAGACGGTGGAAAGCCTGATGGCGACGCTCAAGAAGCAG
CAGCTGGCGCGACAAAAAATAGCCAACCTGGCCCACGCGCGCGAAGACGACCAGATTCGCATTAATGAGCAATCT
GCCGCCTCCCAGCCGAGTTCGTCCTGGGAGACTGAGCTCGTTGCCATGCTCGAGGCTGTTGATGCATCGGCAGCC
GAAGGGCAAGTGGGCAGTCGAGGCATGCTGCCGCCGCCCGCGGTGCTGCGAGCCCGCATCCGCGCCATTGAGGGC
CGGCGCGACTATATGCGCAAAATGGTGCATGCGCTCAAGGGCCGGAGCCGCGAGGTCGAAGTTAAGTACCGCCGC
GTCGTTGCCCTGTGCACCGGCGTGCAGGACAGCGATGTGGATGCCATGGTGGACGGCCTGCTCAAGGCTGTGCGC
AGCGAGGGAGAGGAGCTTGATATCGGGAGGGTAAGGCGCTTTCTCGGTGGCATTGATGGCCCGGTCGACTAG
Gene >OphauB2|2187
ATGGCATCCAAGATGCCGTCGGCGTCACAGGCGTCTCAGCAGTCGTTTAGCATGAGCCAGTCACAGTCACAGCCG
CGTCCTTCGGTGCCCTTTCAGCACGGCTCTAACAAGGCAGCGTCTATTGAGGGCATATATTCGGTTTGTACCCCA
CACGCCGCACGGGGGCGCATGCAGTCGTAGCGTTGCTAACATACTTTAGTCGTCGTATTCCGGCATCGACCTCTA
CGAGATGGAAGTCAATGGCGTTGTTGTGATGCGCCGTCGTCACGACTCGTGGCTCAATGCAACTCAGATCCTAAA
GGTGGCTGGCCTCGACAAGGGCAAGAGAACAAAAATCCTGGAAAAGGAGATCCAAACTGGCGAGCACGAAAAAGT
CCAGGGGGGCTACGGCAAGTACCAGGGCACCTGGATTGCCTTTGACCGTGGCGTCGAAGTCTGCCGTCAGTACGG
CGTTGAGGATCTGCTGCGCCCGCTGCTCACCTACGACATGGGCCAGGACGGCGGAGTGGCTGGCAGAGGCGACTT
CAACACTCCTACTAAAGAACAAGCCATGGCTGCTCAGCGGAAACGCATGTACAATGCCAATGCGAGTGCCGACTC
AAGAGCAAATGGCCTGTCGGGCACATTTTTCAAAAACATTTCCACCACTGCGTCTCACGCTGTCGCTGCTATTAG
CAAAGCCCGCTTTGACTCACCTGGTCCAAGAAATCGCAACGGCCCCTCTCGCCCGCCTAGCTTCAGTCGCCAGCC
GTCTATTCAAAAAAACAGCGAAAATCATATGCCCAATAGTACACAGCAAAGTTTTGCATCTGAATACGCTCAACA
GCAGACAGATACCAGTAGCTATCAGACCCAGCCACCGAATGGCAGCGCAGGCACAATGCACGACAACGAGCCCCC
TCGCAAGAGACAGCGAGTCACAATGACGCCTGCTGACAGCTATGGCAGCTACAACCAGCATGTAGCTGATGTGTA
CCCCAACGCTGGCCCTGTCGGCTCTCCCACGGAGCCCAACGACTCCTTCATTTATAACAGCCAAGCTGCCGCCAA
TGACGTTCCCCAGGCCGAAGAAGGCTATGGCACACTGCCTCCTCTGCCTCCTGCCGAGACGGCCGATATAGAAGA
GAAGCGAAGTATGCTGATACGTCTCTTCATGGATCCAGGGTCCTCGACCTCGGATCCGTCCACGTACAGCATGCT
TCACTCCTATACGCCCGCCGAGCTGGACATGCCTATAGATCCACAAAGCCACACGGCGCTTCACTGGGCTGCAAC
TCTGGCCCGCATGCCTCTTCTTCGCGCTCTCATCGCAGCTGGAGCTTCTCCATGGCGTGTCAATGCTTCGGGGGA
GACGGCACTCATGCGAGCTTGTCTTGTGACCAACTCGATGGACCACGGATCCTTTCCCGATCTGCTTGACGTTCT
CGGAGGCACAATTGAAGCACGGGACAACAAGGGGCGGACTGTGCTGCATCACATTTCAGTCACTTCGGCGGTCAA
AGGTCGCAGTGCAGCCAGTCGTTACTACCTCGAGAGTCTGCTTGAATGGGTTGTTCGACAGGGCAGTGCTCCAAA
CAGCCAGCCTGAACAGGCAAATGGAACTTTTTCCGGCACCATGTCGACGATGGCTCCTAAGATGGGCATCGCGCG
CTTCATGTCGGAAATTGTCAATGCCCAGGATGCTTCGGGCGATACCGCCCTCAATATTGCTTCGAGGATCGGCAA
CCGCAGCATCATTTCTCAGCTGCTGGAAGTAAGCGCTGATCCCGAGATTGCCAACCGCGTTGGCCTCCGACCTTC
AGATTTCGGCATAGGCAAGGACGAAAGCGACGGTCGCATCAGTGGCCAGGCTGCGGAAGAGGTCAATGGCGTCTC
AGGCATTAGCCAGCGTTCTAGCGACAAGAATGACGATATTATGACGTGTAAGCATGCCCGCCGAGTTGACGTGTA
TTGTTGCCACGCTGACTAGAGAGCATAGCAATCACGCGCCTCCTGGAAGATACTGGCGCGAGCTTCCAGCAAGAG
CTCAAGGACAAGCAAGCCTCTCTGGACACTCTTCATGCCACACTCAGATCAACGTCTGGCCAATTGGGCGAAGCT
AAAAAGACGGTGGAAAGCCTGATGGCGACGCTCAAGAAGCAGCAGCTGGCGCGACAAAAAATAGCCAACCTGGCC
CACGCGCGCGAAGACGACCAGATTCGCATTAATGAGCAATCTGCCGCCTCCCAGCCGAGTTCGTCCTGGGAGACT
GAGCTCGTTGCCATGCTCGAGGCTGTTGATGCATCGGCAGCCGAAGGGCAAGTGGGCAGTCGAGGCATGCTGCCG
CCGCCCGCGGTGCTGCGAGCCCGCATCCGCGCCATTGAGGGCCGGCGCGACTATATGCGCAAAATGGTGCATGCG
CTCAAGGGCCGGAGCCGCGAGGTCGAAGTTAAGTACCGCCGCGTCGTTGCCCTGTGCACCGGCGTGCAGGACAGC
GATGTGGATGCCATGGTGGACGGCCTGCTCAAGGCTGTGCGCAGCGAGGGAGAGGAGCTTGATATCGGGAGGGTA
AGGCGCTTTCTCGGTGGCATTGATGGCCCGGTCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail