Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2169
Gene name
LocationContig_166:13870..14788
Strand+
Gene length (bp)918
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05916 Sld5 GINS complex protein 2.7E-12 21 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IP51|PSF1_GIBZE DNA replication complex GINS protein PSF1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PSF1 PE=3 SV=1 1 212 6.0E-133
sp|Q2HDQ7|PSF1_CHAGB DNA replication complex GINS protein PSF1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PSF1 PE=3 SV=1 1 212 2.0E-127
sp|Q7SDH9|PSF1_NEUCR DNA replication complex GINS protein psf1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drc-1 PE=3 SV=1 1 212 6.0E-125
sp|Q5B714|PSF1_EMENI DNA replication complex GINS protein psf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=psf1 PE=3 SV=1 1 211 7.0E-100
sp|Q0UN58|PSF1_PHANO DNA replication complex GINS protein PSF1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PSF1 PE=3 SV=1 1 211 3.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IP51|PSF1_GIBZE DNA replication complex GINS protein PSF1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PSF1 PE=3 SV=1 1 212 6.0E-133
sp|Q2HDQ7|PSF1_CHAGB DNA replication complex GINS protein PSF1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PSF1 PE=3 SV=1 1 212 2.0E-127
sp|Q7SDH9|PSF1_NEUCR DNA replication complex GINS protein psf1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drc-1 PE=3 SV=1 1 212 6.0E-125
sp|Q5B714|PSF1_EMENI DNA replication complex GINS protein psf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=psf1 PE=3 SV=1 1 211 7.0E-100
sp|Q0UN58|PSF1_PHANO DNA replication complex GINS protein PSF1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PSF1 PE=3 SV=1 1 211 3.0E-95
sp|Q6BKI2|PSF1_DEBHA DNA replication complex GINS protein PSF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PSF1 PE=3 SV=1 1 211 4.0E-58
sp|Q6CHE4|PSF1_YARLI DNA replication complex GINS protein PSF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PSF1 PE=3 SV=1 1 211 2.0E-57
sp|Q12488|PSF1_YEAST DNA replication complex GINS protein PSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSF1 PE=1 SV=1 1 211 2.0E-57
sp|Q75E92|PSF1_ASHGO DNA replication complex GINS protein PSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF1 PE=3 SV=1 1 211 3.0E-57
sp|Q6CW43|PSF1_KLULA DNA replication complex GINS protein PSF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PSF1 PE=3 SV=2 1 211 1.0E-56
sp|Q9P7X6|PSF1_SCHPO DNA replication complex GINS protein psf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psf1 PE=3 SV=1 3 211 1.0E-56
sp|Q6FVY5|PSF1_CANGA DNA replication complex GINS protein PSF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PSF1 PE=3 SV=1 1 211 3.0E-55
sp|Q59S42|PSF1_CANAL DNA replication complex GINS protein PSF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PSF1 PE=3 SV=1 1 211 4.0E-52
sp|P0CQ28|PSF1_CRYNJ DNA replication complex GINS protein PSF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PSF1 PE=3 SV=1 1 211 3.0E-34
sp|P0CQ29|PSF1_CRYNB DNA replication complex GINS protein PSF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PSF1 PE=3 SV=1 1 211 3.0E-34
sp|A4IFH4|PSF1_BOVIN DNA replication complex GINS protein PSF1 OS=Bos taurus GN=GINS1 PE=2 SV=1 1 209 6.0E-16
sp|Q54HR6|PSF1_DICDI Probable DNA replication complex GINS protein PSF1 OS=Dictyostelium discoideum GN=gins1 PE=3 SV=1 1 211 2.0E-15
sp|Q14691|PSF1_HUMAN DNA replication complex GINS protein PSF1 OS=Homo sapiens GN=GINS1 PE=1 SV=1 1 211 4.0E-15
sp|Q9CZ15|PSF1_MOUSE DNA replication complex GINS protein PSF1 OS=Mus musculus GN=Gins1 PE=1 SV=1 1 209 1.0E-14
sp|Q22019|PSF1_CAEEL Probable DNA replication complex GINS protein PSF1 OS=Caenorhabditis elegans GN=psf-1 PE=3 SV=2 3 209 1.0E-14
sp|Q626F4|PSF1_CAEBR Probable DNA replication complex GINS protein PSF1 OS=Caenorhabditis briggsae GN=psf-1 PE=3 SV=1 3 209 4.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2169
MYGDLGIKLVRHAKRTQKLAHLPPYQTELVRAVTREVRDLDRDVSDLLEPFQGSFDPSADQALACTLLVNHLSMR
RDKRCLLCYHRTRTDKLEDLVWKGADVVDLSGQQVYQASSEGGGDDGSTSSLSPQEEEYVRRYSDLLAAYKGHWT
DVDLTGSLEPPRDLFIDVRVLKDAGEIQTEYGAINLTKNSQFYVRQGDVERLIAQGYLQKLGHIATKVPQAHAKR
QKCVHD*
Coding >OphauB2|2169
ATGTATGGCGACCTGGGAATCAAGCTGGTGCGACATGCCAAACGCACGCAGAAGCTGGCCCATCTGCCGCCGTAT
CAGACGGAGCTGGTGCGCGCCGTGACGCGGGAGGTGAGGGATCTGGACAGAGATGTCAGCGACCTCCTCGAGCCA
TTTCAGGGCTCTTTTGATCCTTCGGCAGACCAGGCATTGGCATGTACTTTACTGGTGAATCACCTGTCGATGCGT
CGCGACAAGCGCTGCCTTCTCTGTTACCATCGGACGCGGACAGACAAACTTGAAGACTTGGTGTGGAAGGGAGCA
GATGTTGTTGATCTTTCGGGTCAGCAGGTATACCAGGCGAGTAGCGAAGGCGGTGGCGATGACGGATCGACAAGC
AGCCTCAGCCCGCAGGAAGAGGAGTACGTGAGACGATACAGCGATCTACTGGCAGCCTACAAGGGTCACTGGACA
GATGTCGATCTGACGGGTAGTTTGGAACCGCCGCGAGACCTTTTTATTGACGTGCGAGTTCTCAAGGACGCGGGG
GAGATACAAACGGAATATGGGGCCATTAACTTGACAAAAAACAGTCAATTCTACGTGCGGCAGGGCGACGTGGAG
CGGCTGATCGCCCAGGGATACCTACAGAAACTCGGTCACATTGCTACAAAGGTGCCCCAGGCCCATGCAAAGAGA
CAAAAATGCGTCCATGACTAA
Transcript >OphauB2|2169
ATGTATGGCGACCTGGGAATCAAGCTGGTGCGACATGCCAAACGCACGCAGAAGCTGGCCCATCTGCCGCCGTAT
CAGACGGAGCTGGTGCGCGCCGTGACGCGGGAGGTGAGGGATCTGGACAGAGATGTCAGCGACCTCCTCGAGCCA
TTTCAGGGCTCTTTTGATCCTTCGGCAGACCAGGCATTGGCATGTACTTTACTGGTGAATCACCTGTCGATGCGT
CGCGACAAGCGCTGCCTTCTCTGTTACCATCGGACGCGGACAGACAAACTTGAAGACTTGGTGTGGAAGGGAGCA
GATGTTGTTGATCTTTCGGGTCAGCAGGTATACCAGGCGAGTAGCGAAGGCGGTGGCGATGACGGATCGACAAGC
AGCCTCAGCCCGCAGGAAGAGGAGTACGTGAGACGATACAGCGATCTACTGGCAGCCTACAAGGGTCACTGGACA
GATGTCGATCTGACGGGTAGTTTGGAACCGCCGCGAGACCTTTTTATTGACGTGCGAGTTCTCAAGGACGCGGGG
GAGATACAAACGGAATATGGGGCCATTAACTTGACAAAAAACAGTCAATTCTACGTGCGGCAGGGCGACGTGGAG
CGGCTGATCGCCCAGGGATACCTACAGAAACTCGGTCACATTGCTACAAAGGTGCCCCAGGCCCATGCAAAGAGA
CAAAAATGCGTCCATGACTAA
Gene >OphauB2|2169
ATGTATGGCGACCTGGGAATCAAGCTGGTCGGCGCCCTTGTGTCTGGATTGGCGCAATATGGAAAACTCACTCGC
TTCTGCAGGTGCGACATGCCAAACGCACGCAGAAGCTGGCCCATCTGCCGCCGTATCAGACGGAGCTGGTGCGCG
CCGTGACGCGGGAGGTGAGGGATCTGGACAGAGATGTCAGCGACCTCCTCGAGCCATTTCAGGGCTCTTTTGATC
CTTCGGCAGACCAGGCATTGGCATGTACTTTACTGGTGAATCACCTGTCGATGCGTCGCGACAAGCGCTGCCTTC
TCTGTTACCATCGGACGCGGACAGACAAACTTGAAGACTTGGTGTGGAAGGGAGCAGATGTTGTTGATCTTTCGG
GTCAGCAGGTATACCAGGCGAGTAGCGAAGGCGGTGGCGATGACGGATCGACAAGCAGCCTCAGCCCGCAGGAAG
AGGAGTACGTGAGACGATACAGCGATCTACTGGCAGCCTACAAGGGTCACTGGACAGATGTCGATCTGACGGGTA
GTTTGGAACCGCCGCGAGACCTTTTTATTGACGTGCGAGTTCTCAAGGACGCGGGGGAGATACAAACGGAATATG
GGCACGTGCAACCCGAGCAGTGGGAACCACGGGCGTGTGGCTGACGCGACTTTGACAGGGCCATTAACTTGACAA
AAAACAGTCAATTCTACGTGCGGCAGGGCGACGTGGAGCGGCTGATCGCCCAGGGATACCTACAGAAACTCGGTC
AGTAGGTAGTGTTGCCATATGCGAGGCAGCGGCTATGAATACATGAAGTGGTGTAGCATTGCTACAAAGGTATGC
AGTTGGGGAATGTGCCACGTCGTGCGACGATGATGCAAATGGTTCTAGGTGCCCCAGGCCCATGCAAAGAGACAA
AAATGCGTCCATGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail