Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2167
Gene name
LocationContig_166:8631..9870
Strand-
Gene length (bp)1239
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 8.7E-07 301 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43120|UAP2_SCHPO Splicing factor U2AF-associated protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap2 PE=1 SV=1 81 369 6.0E-61
sp|Q8BGC0|HTSF1_MOUSE HIV Tat-specific factor 1 homolog OS=Mus musculus GN=Htatsf1 PE=1 SV=1 37 362 1.0E-32
sp|O43719|HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens GN=HTATSF1 PE=1 SV=1 37 362 5.0E-30
sp|Q5RB63|HTSF1_PONAB HIV Tat-specific factor 1 homolog OS=Pongo abelii GN=HTATSF1 PE=2 SV=1 37 362 8.0E-30
sp|P53830|CUS2_YEAST Cold sensitive U2 snRNA suppressor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUS2 PE=1 SV=1 110 375 3.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43120|UAP2_SCHPO Splicing factor U2AF-associated protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap2 PE=1 SV=1 81 369 6.0E-61
sp|Q8BGC0|HTSF1_MOUSE HIV Tat-specific factor 1 homolog OS=Mus musculus GN=Htatsf1 PE=1 SV=1 37 362 1.0E-32
sp|O43719|HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens GN=HTATSF1 PE=1 SV=1 37 362 5.0E-30
sp|Q5RB63|HTSF1_PONAB HIV Tat-specific factor 1 homolog OS=Pongo abelii GN=HTATSF1 PE=2 SV=1 37 362 8.0E-30
sp|P53830|CUS2_YEAST Cold sensitive U2 snRNA suppressor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUS2 PE=1 SV=1 110 375 3.0E-21
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 150 359 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2167
MESDFPTNLDDFDADERISYSKLDDKYIAVHDNGGEFEFDLELKRWLPMNADDVEDTGDALDIGGHGPDGLGDGV
QRKRKQGADKGSENADSSQAARPSKKTKAPPKPKQNTAVYVTGLPPDASVPEIHDVFSRKGGLIAEEIDSGAPRI
KLYRDDAGHFKGDALIVFFKPDSVRMAIMLLDDTYFRYTPSGQGQGKIHVQEADSSYKKVQQHQQDTNAARSPSD
AAQNMPEARRPKKDKDRQKIIRKTQKLDAKLADWSDDEDDRFPGVNDARSFKTVVLRQMFRIFELEEDPAAILDI
KQDIREECSKLGTVTNVVLYDQEPEGIVTVRFQEADAARACIKAMNGRPFDGRVVEASLGTGKERFRRSDNKEHD
*
Coding >OphauB2|2167
ATGGAAAGCGACTTTCCAACCAATCTCGATGATTTTGATGCAGACGAGCGCATCTCCTACTCCAAGCTCGATGAC
AAGTACATTGCTGTACACGACAACGGTGGCGAGTTTGAATTCGACCTCGAGCTGAAGCGGTGGCTGCCAATGAAT
GCGGACGATGTGGAAGACACAGGCGACGCGTTAGATATTGGAGGCCATGGCCCAGATGGCCTAGGCGATGGGGTT
CAGAGAAAGCGAAAGCAAGGCGCTGACAAGGGAAGCGAGAATGCCGATTCCTCTCAGGCCGCCCGGCCAAGTAAA
AAGACAAAGGCGCCGCCCAAGCCCAAGCAGAACACGGCCGTGTACGTGACGGGCCTGCCGCCAGACGCATCCGTG
CCCGAAATCCACGACGTCTTCTCCCGCAAGGGGGGCCTCATTGCCGAGGAAATCGATAGCGGTGCCCCGCGCATC
AAGCTCTACAGAGACGATGCTGGACACTTCAAGGGTGACGCGCTCATTGTCTTTTTCAAGCCCGACAGCGTGCGC
ATGGCCATTATGCTTCTCGACGACACTTATTTTAGATACACGCCCAGTGGCCAGGGCCAAGGCAAGATACACGTC
CAAGAAGCCGACTCGAGCTATAAAAAGGTGCAGCAGCACCAGCAAGACACCAATGCTGCAAGATCCCCCTCGGAC
GCGGCGCAAAACATGCCAGAGGCACGACGGCCCAAGAAGGACAAGGATAGACAAAAGATTATCCGCAAAACACAG
AAACTCGATGCCAAACTGGCTGATTGGAGCGACGATGAGGATGATCGATTTCCAGGTGTTAACGACGCCAGGAGT
TTCAAGACGGTTGTCCTCCGCCAAATGTTCCGCATCTTTGAACTTGAAGAGGATCCAGCAGCGATTCTGGACATC
AAGCAAGATATTCGTGAAGAGTGTTCCAAGCTGGGCACAGTAACTAATGTGGTGCTTTATGACCAAGAGCCAGAA
GGCATTGTGACTGTTCGCTTTCAAGAGGCAGACGCTGCCAGGGCGTGCATCAAAGCCATGAACGGACGGCCCTTT
GACGGGCGCGTCGTTGAGGCTTCTCTTGGCACAGGCAAAGAAAGATTTAGAAGGAGTGACAACAAGGAGCACGAT
TGA
Transcript >OphauB2|2167
ATGGAAAGCGACTTTCCAACCAATCTCGATGATTTTGATGCAGACGAGCGCATCTCCTACTCCAAGCTCGATGAC
AAGTACATTGCTGTACACGACAACGGTGGCGAGTTTGAATTCGACCTCGAGCTGAAGCGGTGGCTGCCAATGAAT
GCGGACGATGTGGAAGACACAGGCGACGCGTTAGATATTGGAGGCCATGGCCCAGATGGCCTAGGCGATGGGGTT
CAGAGAAAGCGAAAGCAAGGCGCTGACAAGGGAAGCGAGAATGCCGATTCCTCTCAGGCCGCCCGGCCAAGTAAA
AAGACAAAGGCGCCGCCCAAGCCCAAGCAGAACACGGCCGTGTACGTGACGGGCCTGCCGCCAGACGCATCCGTG
CCCGAAATCCACGACGTCTTCTCCCGCAAGGGGGGCCTCATTGCCGAGGAAATCGATAGCGGTGCCCCGCGCATC
AAGCTCTACAGAGACGATGCTGGACACTTCAAGGGTGACGCGCTCATTGTCTTTTTCAAGCCCGACAGCGTGCGC
ATGGCCATTATGCTTCTCGACGACACTTATTTTAGATACACGCCCAGTGGCCAGGGCCAAGGCAAGATACACGTC
CAAGAAGCCGACTCGAGCTATAAAAAGGTGCAGCAGCACCAGCAAGACACCAATGCTGCAAGATCCCCCTCGGAC
GCGGCGCAAAACATGCCAGAGGCACGACGGCCCAAGAAGGACAAGGATAGACAAAAGATTATCCGCAAAACACAG
AAACTCGATGCCAAACTGGCTGATTGGAGCGACGATGAGGATGATCGATTTCCAGGTGTTAACGACGCCAGGAGT
TTCAAGACGGTTGTCCTCCGCCAAATGTTCCGCATCTTTGAACTTGAAGAGGATCCAGCAGCGATTCTGGACATC
AAGCAAGATATTCGTGAAGAGTGTTCCAAGCTGGGCACAGTAACTAATGTGGTGCTTTATGACCAAGAGCCAGAA
GGCATTGTGACTGTTCGCTTTCAAGAGGCAGACGCTGCCAGGGCGTGCATCAAAGCCATGAACGGACGGCCCTTT
GACGGGCGCGTCGTTGAGGCTTCTCTTGGCACAGGCAAAGAAAGATTTAGAAGGAGTGACAACAAGGAGCACGAT
TGA
Gene >OphauB2|2167
ATGGAAAGCGACTTTCCAACCAATCTCGATGATTTTGATGCAGACGAGCGCATCTCCTACTCCAAGCTCGATGAC
AAGTACATTGCTGTACACGACAACGGTGGCGAGTTTGAATTCGACCTCGAGCTGAAGCGGTGGCTGCCAATGAAT
GCGGACGATGTGGAAGACACAGGCGACGCGTTAGATATTGGAGGCCATGGCCCAGATGGCCTAGGCGATGGGGTT
CAGAGAAAGCGAAAGCAAGGCGCTGACAAGGGAAGCGAGGTGAGCACCGGGCCGAGGCTCAGTGCAGACGTGATA
GCAAGACTGGCAGCTGGGCGCTGGAAACTCGAGGCTCGACAATTACCCTGACGCTTTGATTTTTCTCTGCAGCAG
AATGCCGATTCCTCTCAGGCCGCCCGGCCAAGTAAAAAGACAAAGGCGCCGCCCAAGCCCAAGCAGAACACGGCC
GTGTACGTGACGGGCCTGCCGCCAGACGCATCCGTGCCCGAAATCCACGACGTCTTCTCCCGCAAGGGGGGCCTC
ATTGCCGAGGAAATCGATAGCGGTGCCCCGCGCATCAAGCTCTACAGAGACGATGCTGGACACTTCAAGGGTGAC
GCGCTCATTGTCTTTTTCAAGCCCGACAGCGTGCGCATGGCCATTATGCTTCTCGACGACACTTATTTTAGATAC
ACGCCCAGTGGCCAGGGCCAAGGCAAGATACACGTCCAAGAAGCCGACTCGAGCTATAAAAAGGTGCAGCAGCAC
CAGCAAGACACCAATGCTGCAAGATCCCCCTCGGACGCGGCGCAAAACATGCCAGAGGCACGACGGCCCAAGAAG
GACAAGGATAGACAAAAGATTATCCGCAAAACACAGAAACTCGATGCCAAACTGGCTGATTGGAGCGACGATGAG
GATGATCGATTTCCAGGTGTTAACGACGCCAGGAGTTTCAAGACGGTTGTCCTCCGCCAAATGTTCCGCATCTTT
GAACTTGAAGAGGATCCAGCAGCGATTCTGGACATCAAGCAAGATATTCGTGAAGAGTGTTCCAAGCTGGGCACA
GTAACTAATGTGGTGCTTTATGACCAAGAGCCAGAAGGCATTGTGACTGTTCGCTTTCAAGAGGCAGACGCTGCC
AGGGCGTGCATCAAAGCCATGAACGGACGGCCCTTTGACGGGCGCGTCGTTGAGGCTTCTCTTGGCACAGGCAAA
GAAAGATTTAGAAGGAGTGACAACAAGGAGCACGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail