Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2161
Gene name
LocationContig_165:39928..41311
Strand-
Gene length (bp)1383
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01636 APH Phosphotransferase enzyme family 5.1E-35 28 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K370|ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus GN=Acad10 PE=1 SV=1 9 335 3.0E-56
sp|Q6JQN1|ACD10_HUMAN Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens GN=ACAD10 PE=1 SV=1 9 335 5.0E-53
sp|Q5R778|ACD11_PONAB Acyl-CoA dehydrogenase family member 11 OS=Pongo abelii GN=ACAD11 PE=2 SV=2 11 332 3.0E-52
sp|B3DMA2|ACD11_RAT Acyl-CoA dehydrogenase family member 11 OS=Rattus norvegicus GN=Acad11 PE=1 SV=1 11 332 2.0E-50
sp|Q80XL6|ACD11_MOUSE Acyl-CoA dehydrogenase family member 11 OS=Mus musculus GN=Acad11 PE=1 SV=2 11 332 2.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K370|ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus GN=Acad10 PE=1 SV=1 9 335 3.0E-56
sp|Q6JQN1|ACD10_HUMAN Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens GN=ACAD10 PE=1 SV=1 9 335 5.0E-53
sp|Q5R778|ACD11_PONAB Acyl-CoA dehydrogenase family member 11 OS=Pongo abelii GN=ACAD11 PE=2 SV=2 11 332 3.0E-52
sp|B3DMA2|ACD11_RAT Acyl-CoA dehydrogenase family member 11 OS=Rattus norvegicus GN=Acad11 PE=1 SV=1 11 332 2.0E-50
sp|Q80XL6|ACD11_MOUSE Acyl-CoA dehydrogenase family member 11 OS=Mus musculus GN=Acad11 PE=1 SV=2 11 332 2.0E-50
sp|Q709F0|ACD11_HUMAN Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens GN=ACAD11 PE=1 SV=2 11 332 3.0E-50
sp|Q8RWZ3|IBR3_ARATH Probable acyl-CoA dehydrogenase IBR3 OS=Arabidopsis thaliana GN=IBR3 PE=1 SV=1 9 317 6.0E-47
sp|Q5ZHT1|ACD11_CHICK Acyl-CoA dehydrogenase family member 11 OS=Gallus gallus GN=ACAD11 PE=2 SV=1 33 332 9.0E-47
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2161
MAGKIRQPIDEAAFSKYLEGNVKEVKTPVELKQSNPTYQVTDATRQRFVMRKKPPGRLLSKTAHQVEREWRIMAA
LRATPVAVPKMYTLCQDASIIGTPFYIMEYLDGRIFQDMAMPGVERGEREAMWRAAVEMLAELHRIKTWKGICGK
QEEVVDVESGEKVGRLPHFEELVGFFANGAAQPRDRAGLVHGDYKIDNVVFAKTQPRVLGILDWEMSTVGHPLSD
LCNLLMPFYLAQDAAISRLSPSHAAMLPGRTPGLPSPRQLLDWYAATSGYDAAADLKWGMAFNVFKLAGVFQGIA
ARYALRQASSAQARQVGEMRGATAELAWRLAQEAGANKARL*
Coding >OphauB2|2161
ATGGCGGGCAAGATTCGACAGCCGATTGACGAGGCGGCCTTTAGCAAGTATCTGGAGGGCAATGTCAAGGAGGTT
AAGACGCCGGTTGAGCTCAAGCAGTCGAATCCGACATACCAAGTCACCGATGCCACCCGCCAGCGCTTCGTAATG
CGCAAGAAGCCGCCCGGCCGCCTCCTCTCCAAAACCGCCCACCAAGTCGAGCGCGAATGGCGCATCATGGCCGCC
CTCCGCGCCACGCCCGTGGCCGTGCCCAAAATGTACACGCTCTGCCAAGACGCAAGCATAATCGGCACGCCCTTT
TACATCATGGAGTATCTCGACGGGCGTATTTTCCAAGACATGGCCATGCCGGGGGTGGAGAGGGGCGAGCGAGAG
GCCATGTGGCGCGCAGCAGTGGAGATGCTGGCGGAGCTGCATAGGATTAAGACGTGGAAGGGGATTTGTGGGAAG
CAGGAGGAGGTGGTGGATGTTGAGAGCGGAGAAAAAGTTGGGAGACTGCCGCATTTTGAAGAGTTGGTTGGGTTT
TTTGCAAATGGGGCGGCGCAGCCGAGGGATAGGGCGGGTTTGGTGCATGGGGATTACAAGATTGACAATGTCGTC
TTTGCAAAGACGCAGCCGCGCGTCCTTGGCATTCTCGACTGGGAAATGTCCACCGTCGGCCACCCCCTCTCCGAC
CTCTGCAACCTCCTCATGCCATTCTACCTTGCCCAAGACGCCGCCATTTCCCGCCTCAGCCCCTCCCACGCCGCC
ATGCTGCCCGGCCGCACGCCCGGTCTTCCCTCGCCTCGCCAGCTGCTCGACTGGTATGCCGCTACGTCGGGATAC
GACGCCGCCGCAGACTTGAAGTGGGGCATGGCGTTTAATGTGTTTAAGCTCGCGGGCGTCTTTCAGGGCATTGCG
GCGCGGTATGCGCTGCGGCAGGCGAGTAGTGCGCAGGCGAGGCAGGTGGGCGAGATGCGTGGCGCAACGGCAGAG
TTGGCGTGGAGGTTGGCGCAAGAGGCGGGGGCGAACAAGGCGAGGCTTTAG
Transcript >OphauB2|2161
ATGGCGGGCAAGATTCGACAGCCGATTGACGAGGCGGCCTTTAGCAAGTATCTGGAGGGCAATGTCAAGGAGGTT
AAGACGCCGGTTGAGCTCAAGCAGTCGAATCCGACATACCAAGTCACCGATGCCACCCGCCAGCGCTTCGTAATG
CGCAAGAAGCCGCCCGGCCGCCTCCTCTCCAAAACCGCCCACCAAGTCGAGCGCGAATGGCGCATCATGGCCGCC
CTCCGCGCCACGCCCGTGGCCGTGCCCAAAATGTACACGCTCTGCCAAGACGCAAGCATAATCGGCACGCCCTTT
TACATCATGGAGTATCTCGACGGGCGTATTTTCCAAGACATGGCCATGCCGGGGGTGGAGAGGGGCGAGCGAGAG
GCCATGTGGCGCGCAGCAGTGGAGATGCTGGCGGAGCTGCATAGGATTAAGACGTGGAAGGGGATTTGTGGGAAG
CAGGAGGAGGTGGTGGATGTTGAGAGCGGAGAAAAAGTTGGGAGACTGCCGCATTTTGAAGAGTTGGTTGGGTTT
TTTGCAAATGGGGCGGCGCAGCCGAGGGATAGGGCGGGTTTGGTGCATGGGGATTACAAGATTGACAATGTCGTC
TTTGCAAAGACGCAGCCGCGCGTCCTTGGCATTCTCGACTGGGAAATGTCCACCGTCGGCCACCCCCTCTCCGAC
CTCTGCAACCTCCTCATGCCATTCTACCTTGCCCAAGACGCCGCCATTTCCCGCCTCAGCCCCTCCCACGCCGCC
ATGCTGCCCGGCCGCACGCCCGGTCTTCCCTCGCCTCGCCAGCTGCTCGACTGGTATGCCGCTACGTCGGGATAC
GACGCCGCCGCAGACTTGAAGTGGGGCATGGCGTTTAATGTGTTTAAGCTCGCGGGCGTCTTTCAGGGCATTGCG
GCGCGGTATGCGCTGCGGCAGGCGAGTAGTGCGCAGGCGAGGCAGGTGGGCGAGATGCGTGGCGCAACGGCAGAG
TTGGCGTGGAGGTTGGCGCAAGAGGCGGGGGCGAACAAGGCGAGGCTTTAG
Gene >OphauB2|2161
ATGGCGGGCAAGATTCGACAGCCGATTGACGAGGCGGCCTTTAGCAAGTATCTGGAGGGCAATGTCAAGGAGGTT
AAGACGCCGGTTGAGCTCAAGCAGGTGCGTGGATGAGGCCAAACATTGCTTCTCATGAGACTTGGGAGCCTCATT
TTCCCCCTCTCACAGAGGCAAAAATTACTAACGGGACCAACCCCCCCCCCCCTTTTGACAGTTTGGCTTTGGGCA
GTCGAATCCGACATACCAAGTCACCGATGCCACCCGCCAGCGCTTCGTAATGCGCAAGAAGCCGCCCGGCCGCCT
CCTCTCCAAAACCGCCCACCAAGTCGAGCGCGAATGGCGCATCATGGCCGCCCTCCGCGCCACGCCCGTGGCCGT
GCCCAAAATGTACACGCTCTGCCAAGACGCAAGCATAATCGGCACGCCCTTTTACATCATGGAGTATCTCGACGG
GCGTATTTTCCAAGACATGGCCATGCCGGGGGTGGAGAGGGGCGAGCGAGAGGCCATGTGGCGCGCAGCAGTGGA
GATGCTGGCGGAGCTGCATAGGGTGAGTGTGCGAGGGGTTGGGTTGGAGGGGTTTGGAAGGGGAGAGGGGTTTTA
TGATAGGCAGATTAAGACGTGGAAGGGGATTTGTGGGAAGCAGGAGGAGGTGGTGGATGTTGAGAGCGGAGAAAA
AGTTGGGAGACTGCCGCATTTTGAAGAGTTGGTTGGGTTTTTTGCAAATGGGGCGGCGCAGCCGAGGGATAGGGC
GGGTTTGGTGCATGGGGATTACAAGATTGACAATGTCGTCTTTGCAAAGACGCAGCCGCGCGTCCTTGGCATTCT
CGAGTATGTCGTCTTTTATCCCTCCTCACTCCTTTTCCCCCTATATTGCTCACTCCTTTTCCCCCTCTTTCCACC
ACAGCCCAAACTCCCTCCCCTTTCTCCAATACATCAAACTAACCCTCCCCCCCTTTCTCCAATACATCAAACTAA
CCCCCCTCCCCCCTTTCTAGCTGGGAAATGTCCACCGTCGGCCACCCCCTCTCCGACCTCTGCAACCTCCTCATG
CCATTCTACCTTGCCCAAGACGCCGCCATTTCCCGCCTCAGCCCCTCCCACGCCGCCATGCTGCCCGGCCGCACG
CCCGGTCTTCCCTCGCCTCGCCAGCTGCTCGACTGGTATGCCGCTACGTCGGGATACGACGCCGCCGCAGACTTG
AAGTGGGGCATGGCGTTTAATGTGTTTAAGCTCGCGGGCGTCTTTCAGGGCATTGCGGCGCGGTATGCGCTGCGG
CAGGCGAGTAGTGCGCAGGCGAGGCAGGTGGGCGAGATGCGTGGCGCAACGGCAGAGTTGGCGTGGAGGTTGGCG
CAAGAGGCGGGGGCGAACAAGGCGAGGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail