Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2156
Gene name
LocationContig_165:29598..30676
Strand-
Gene length (bp)1078
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.6E-21 4 74

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 2 87 4.0E-25
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 3 89 2.0E-23
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 3 89 2.0E-23
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 3 89 5.0E-23
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 3 89 5.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 2 87 4.0E-25
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 3 89 2.0E-23
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 3 89 2.0E-23
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 3 89 5.0E-23
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 3 89 5.0E-23
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 3 89 5.0E-23
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 2 80 3.0E-22
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 3 78 6.0E-21
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 3 78 7.0E-21
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 3 86 2.0E-20
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 3 78 2.0E-20
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 3 101 3.0E-20
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 3 78 6.0E-20
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 3 78 8.0E-20
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 3 78 3.0E-19
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 3 78 4.0E-19
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 3 78 1.0E-18
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 3 78 2.0E-18
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 3 78 2.0E-18
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 3 78 1.0E-17
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 2 80 2.0E-17
sp|Q7ZWA3|RBMX_DANRE RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 3 79 2.0E-17
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 3 78 2.0E-17
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 2 80 4.0E-17
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 2 78 4.0E-17
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 3 87 4.0E-17
sp|Q9H0Z9|RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens GN=RBM38 PE=1 SV=2 1 78 5.0E-17
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 2 87 6.0E-17
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 3 78 8.0E-17
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 2 87 9.0E-17
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 3 78 1.0E-16
sp|Q6DIV4|RBM38_XENTR RNA-binding protein 38 OS=Xenopus tropicalis GN=rbm38 PE=2 SV=1 1 78 3.0E-16
sp|Q7T3I7|RBM38_XENLA RNA-binding protein 38 OS=Xenopus laevis GN=rbm38 PE=1 SV=2 1 179 4.0E-16
sp|Q9BX46|RBM24_HUMAN RNA-binding protein 24 OS=Homo sapiens GN=RBM24 PE=1 SV=1 2 78 4.0E-16
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 3 78 4.0E-16
sp|D3Z4I3|RBM24_MOUSE RNA-binding protein 24 OS=Mus musculus GN=Rbm24 PE=3 SV=1 2 78 5.0E-16
sp|Q5ZJX4|RBM38_CHICK RNA-binding protein 38 OS=Gallus gallus GN=RBM38 PE=2 SV=1 1 78 5.0E-16
sp|Q6GQD3|RB24A_XENLA RNA-binding protein 24-A OS=Xenopus laevis GN=rbm24-a PE=2 SV=1 2 78 6.0E-16
sp|Q9I8B3|RB24B_XENLA RNA-binding protein 24-B OS=Xenopus laevis GN=rbm24-b PE=2 SV=1 2 78 6.0E-16
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 3 87 7.0E-16
sp|Q6P8A7|RBM24_XENTR RNA-binding protein 24 OS=Xenopus tropicalis GN=rbm24 PE=2 SV=1 2 78 8.0E-16
sp|Q9SIX3|RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBG1 PE=2 SV=2 3 73 8.0E-16
sp|Q76LC6|RBM24_DANRE RNA-binding protein 24 OS=Danio rerio GN=rbm24 PE=2 SV=1 2 78 9.0E-16
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 3 79 1.0E-15
sp|Q5ZMA3|RBM24_CHICK RNA-binding protein 24 OS=Gallus gallus GN=RBM24 PE=2 SV=2 2 78 1.0E-15
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 3 79 2.0E-15
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 3 78 2.0E-15
sp|Q9FZ84|RBG6_ARATH Glycine-rich RNA-binding protein 6, mitochondrial OS=Arabidopsis thaliana GN=RBG6 PE=2 SV=1 2 73 2.0E-15
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 3 79 2.0E-15
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 3 79 2.0E-15
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 3 79 2.0E-15
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 3 79 2.0E-15
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 2 84 2.0E-15
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 2 87 3.0E-15
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 3 79 3.0E-15
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 3 79 3.0E-15
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 2 87 3.0E-15
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 3 78 3.0E-15
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 3 78 6.0E-15
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 3 79 8.0E-15
sp|Q62176|RBM38_MOUSE RNA-binding protein 38 OS=Mus musculus GN=Rbm38 PE=1 SV=2 1 78 9.0E-15
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 3 79 9.0E-15
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 3 79 9.0E-15
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 3 79 1.0E-14
sp|Q9C909|RBG5_ARATH Glycine-rich RNA-binding protein 5, mitochondrial OS=Arabidopsis thaliana GN=RBG5 PE=2 SV=1 2 80 2.0E-14
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 3 87 2.0E-14
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 3 132 4.0E-14
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 3 79 5.0E-14
sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 1 104 5.0E-14
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 3 102 8.0E-14
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 3 132 8.0E-14
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 3 132 8.0E-14
sp|P39697|RT19_ARATH 40S ribosomal protein S19, mitochondrial OS=Arabidopsis thaliana GN=RPS19 PE=1 SV=2 2 80 9.0E-14
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 2 78 2.0E-13
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 3 132 2.0E-13
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 3 132 2.0E-13
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 3 132 2.0E-13
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 3 84 3.0E-13
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 3 102 4.0E-13
sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 1 78 9.0E-13
sp|P0C8Z4|RMXL3_PANTR RNA-binding motif protein, X-linked-like-3 OS=Pan troglodytes GN=RBMXL3 PE=3 SV=1 3 75 1.0E-12
sp|Q8N7X1|RMXL3_HUMAN RNA-binding motif protein, X-linked-like-3 OS=Homo sapiens GN=RBMXL3 PE=2 SV=2 3 75 1.0E-12
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 3 85 2.0E-12
sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 1 78 2.0E-12
sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 1 78 2.0E-12
sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 1 78 2.0E-12
sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 1 78 2.0E-12
sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 1 78 2.0E-12
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 1 73 3.0E-12
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 1 73 3.0E-12
sp|Q61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1 2 73 3.0E-12
sp|Q8K3P4|MSI1H_RAT RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1 2 73 3.0E-12
sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 2 73 3.0E-12
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 3 103 4.0E-12
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 4 88 6.0E-12
sp|P48809|RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster GN=Hrb27C PE=1 SV=2 3 159 7.0E-12
sp|P48809|RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster GN=Hrb27C PE=1 SV=2 3 73 7.0E-12
sp|Q9C652|RBP1_ARATH RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBP1 PE=2 SV=1 3 60 7.0E-12
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 3 78 7.0E-12
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 2 84 9.0E-12
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 1 73 1.0E-11
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 1 73 1.0E-11
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 1 81 1.0E-11
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 1 81 1.0E-11
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 2 84 2.0E-11
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 3 75 2.0E-11
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 3 80 2.0E-11
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 3 76 3.0E-11
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 3 76 3.0E-11
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 2 87 3.0E-11
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 1 81 3.0E-11
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 3 73 3.0E-11
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 1 81 3.0E-11
sp|Q8GZ26|BRN2L_ARATH RNA-binding protein BRN2 OS=Arabidopsis thaliana GN=BRN2 PE=2 SV=1 2 82 3.0E-11
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 1 81 3.0E-11
sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 4 76 3.0E-11
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 4 76 3.0E-11
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 1 59 3.0E-11
sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 3 78 4.0E-11
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 1 81 4.0E-11
sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 3 73 5.0E-11
sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 3 78 5.0E-11
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 4 76 5.0E-11
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 4 76 5.0E-11
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 4 76 5.0E-11
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 4 76 5.0E-11
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 2 84 6.0E-11
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 3 73 6.0E-11
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 2 91 6.0E-11
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 1 73 6.0E-11
sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 3 73 7.0E-11
sp|Q28521|ROA1_MACMU Heterogeneous nuclear ribonucleoprotein A1 OS=Macaca mulatta GN=HNRNPA1 PE=2 SV=3 1 73 7.0E-11
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 1 73 7.0E-11
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 1 73 7.0E-11
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 1 73 7.0E-11
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 1 73 7.0E-11
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 3 76 8.0E-11
sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 3 92 9.0E-11
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 3 76 1.0E-10
sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2 1 73 1.0E-10
sp|Q6URK4|ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1 1 73 1.0E-10
sp|Q8BG05|ROA3_MOUSE Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1 1 73 1.0E-10
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 1 73 1.0E-10
sp|Q54Y98|TRA2_DICDI Transformer-2 protein homolog OS=Dictyostelium discoideum GN=tra2 PE=3 SV=1 4 83 1.0E-10
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 3 79 1.0E-10
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 4 78 1.0E-10
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 2 79 1.0E-10
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 2 84 2.0E-10
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 3 83 2.0E-10
sp|Q9M1S3|ARP1_ARATH Probable RNA-binding protein ARP1 OS=Arabidopsis thaliana GN=ARP1 PE=2 SV=1 1 82 2.0E-10
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 1 56 2.0E-10
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 2 103 2.0E-10
sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 2 119 2.0E-10
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 1 84 2.0E-10
sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 2 73 2.0E-10
sp|Q61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1 3 92 3.0E-10
sp|Q8K3P4|MSI1H_RAT RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1 3 92 3.0E-10
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 1 56 3.0E-10
sp|Q9CX86|ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus GN=Hnrnpa0 PE=1 SV=1 1 78 3.0E-10
sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens GN=HNRNPA0 PE=1 SV=1 1 78 3.0E-10
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 1 73 5.0E-10
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 2 79 5.0E-10
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 2 84 5.0E-10
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 4 103 5.0E-10
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 4 114 5.0E-10
sp|Q56JZ7|ZCRB1_BOVIN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Bos taurus GN=ZCRB1 PE=2 SV=1 2 106 6.0E-10
sp|Q99729|ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens GN=HNRNPAB PE=1 SV=2 3 78 6.0E-10
sp|Q9BRL6|SRSF8_HUMAN Serine/arginine-rich splicing factor 8 OS=Homo sapiens GN=SRSF8 PE=1 SV=1 1 78 7.0E-10
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 2 79 7.0E-10
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 2 79 7.0E-10
sp|Q8WP23|BOLL_MACFA Protein boule-like OS=Macaca fascicularis GN=BOLL PE=2 SV=2 2 75 8.0E-10
sp|Q02926|RB97D_DROME Ribonucleoprotein RB97D OS=Drosophila melanogaster GN=Rb97D PE=2 SV=1 1 78 8.0E-10
sp|Q99069|GRP1_SORBI Glycine-rich RNA-binding protein 1 (Fragment) OS=Sorghum bicolor GN=GRP1 PE=2 SV=1 17 78 9.0E-10
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 3 73 9.0E-10
sp|Q8N9W6|BOLL_HUMAN Protein boule-like OS=Homo sapiens GN=BOLL PE=1 SV=2 2 75 9.0E-10
sp|Q9CX86|ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus GN=Hnrnpa0 PE=1 SV=1 1 78 1.0E-09
sp|Q99020|ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus GN=Hnrnpab PE=1 SV=1 3 78 1.0E-09
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 4 114 1.0E-09
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 4 79 1.0E-09
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 3 79 1.0E-09
sp|Q8TBF4|ZCRB1_HUMAN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Homo sapiens GN=ZCRB1 PE=1 SV=2 2 106 1.0E-09
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 4 78 2.0E-09
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 2 86 2.0E-09
sp|Q3SWU3|HNRDL_RAT Heterogeneous nuclear ribonucleoprotein D-like OS=Rattus norvegicus GN=Hnrnpdl PE=1 SV=1 2 73 2.0E-09
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 4 78 2.0E-09
sp|Q6DJI9|ZCRB1_XENLA Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Xenopus laevis GN=zcrb1 PE=2 SV=1 2 82 2.0E-09
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 1 84 2.0E-09
sp|Q8VY74|U1135_ARATH U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Arabidopsis thaliana GN=SNRNP35 PE=1 SV=1 4 76 2.0E-09
sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens GN=HNRNPDL PE=1 SV=3 3 73 2.0E-09
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 4 79 2.0E-09
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 4 85 2.0E-09
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 3 73 2.0E-09
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 3 78 3.0E-09
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 4 79 3.0E-09
sp|Q6C747|EIF3G_YARLI Eukaryotic translation initiation factor 3 subunit G OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF35 PE=3 SV=1 4 76 3.0E-09
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 3 73 3.0E-09
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 1 51 3.0E-09
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 3 145 3.0E-09
sp|Q9LES2|UBA2A_ARATH UBP1-associated protein 2A OS=Arabidopsis thaliana GN=UBA2A PE=1 SV=1 3 60 3.0E-09
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 3 145 3.0E-09
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 3 73 3.0E-09
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 3 73 3.0E-09
sp|Q924M5|BOLL_MOUSE Protein boule-like OS=Mus musculus GN=Boll PE=1 SV=2 2 75 3.0E-09
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 3 73 3.0E-09
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 3 73 3.0E-09
sp|Q2R0Q1|U2A2A_ORYSJ Splicing factor U2af large subunit A OS=Oryza sativa subsp. japonica GN=U2AF65A PE=2 SV=2 2 79 3.0E-09
sp|Q7ZX83|HNDLA_XENLA Heterogeneous nuclear ribonucleoprotein D-like-A OS=Xenopus laevis GN=hnrnpdl-a PE=2 SV=1 3 73 3.0E-09
sp|Q9C652|RBP1_ARATH RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBP1 PE=2 SV=1 3 118 4.0E-09
sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens GN=HNRNPA0 PE=1 SV=1 1 78 4.0E-09
sp|Q9CAE4|U1131_ARATH U11/U12 small nuclear ribonucleoprotein 31 kDa protein OS=Arabidopsis thaliana GN=SNRNP31 PE=2 SV=1 2 91 4.0E-09
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 4 79 4.0E-09
sp|Q9ZR40|U2A2B_NICPL Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1 2 79 4.0E-09
sp|Q9SHZ5|UBA1B_ARATH UBP1-associated proteins 1B OS=Arabidopsis thaliana GN=UBA1B PE=2 SV=2 4 60 4.0E-09
sp|B1WC40|NCBP2_RAT Nuclear cap-binding protein subunit 2 OS=Rattus norvegicus GN=Ncbp2 PE=1 SV=1 4 105 4.0E-09
sp|Q9CQ49|NCBP2_MOUSE Nuclear cap-binding protein subunit 2 OS=Mus musculus GN=Ncbp2 PE=1 SV=1 4 105 4.0E-09
sp|Q6NU14|HNDLB_XENLA Heterogeneous nuclear ribonucleoprotein D-like-B OS=Xenopus laevis GN=hnrnpdl-b PE=2 SV=1 2 73 4.0E-09
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 4 79 4.0E-09
sp|P52298|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 OS=Homo sapiens GN=NCBP2 PE=1 SV=1 4 105 5.0E-09
sp|Q3ZBJ1|NCBP2_BOVIN Nuclear cap-binding protein subunit 2 OS=Bos taurus GN=NCBP2 PE=2 SV=1 4 105 5.0E-09
sp|P19018|TRA2_DROME Transformer-2 sex-determining protein OS=Drosophila melanogaster GN=tra2 PE=1 SV=1 6 76 5.0E-09
sp|Q9LKA4|UBA2C_ARATH UBP1-associated protein 2C OS=Arabidopsis thaliana GN=UBA2C PE=2 SV=1 3 85 5.0E-09
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 3 130 5.0E-09
sp|Q9JJ54|HNRPD_RAT Heterogeneous nuclear ribonucleoprotein D0 OS=Rattus norvegicus GN=Hnrnpd PE=1 SV=2 3 73 5.0E-09
sp|Q14103|HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens GN=HNRNPD PE=1 SV=1 3 73 5.0E-09
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 1 78 6.0E-09
sp|Q2QZL4|U2A2B_ORYSJ Splicing factor U2af large subunit B OS=Oryza sativa subsp. japonica GN=U2AF65B PE=3 SV=2 2 79 6.0E-09
sp|Q8JGR6|NCBP2_DANRE Nuclear cap-binding protein subunit 2 OS=Danio rerio GN=ncbp2 PE=2 SV=2 4 110 6.0E-09
sp|Q9SHZ6|UBA1A_ARATH UBP1-associated proteins 1A OS=Arabidopsis thaliana GN=UBA1A PE=1 SV=2 3 60 6.0E-09
sp|Q60668|HNRPD_MOUSE Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus GN=Hnrnpd PE=1 SV=2 3 73 6.0E-09
sp|O94290|IST3_SCHPO U2 snRNP component ist3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf29 PE=1 SV=1 4 76 6.0E-09
sp|O02008|TRA2_DROVI Transformer-2 sex-determining protein OS=Drosophila virilis GN=tra2 PE=3 SV=1 6 76 6.0E-09
sp|Q8R0F5|RBMX2_MOUSE RNA-binding motif protein, X-linked 2 OS=Mus musculus GN=Rbmx2 PE=1 SV=1 4 80 6.0E-09
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 2 78 7.0E-09
sp|C0H859|NCBP2_SALSA Nuclear cap-binding protein subunit 2 OS=Salmo salar GN=ncbp2 PE=2 SV=1 4 108 7.0E-09
sp|Q640A2|HNRDL_XENTR Heterogeneous nuclear ribonucleoprotein D-like OS=Xenopus tropicalis GN=hnrnpdl PE=2 SV=1 3 73 7.0E-09
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 1 51 7.0E-09
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 2 78 8.0E-09
sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2 1 78 8.0E-09
sp|Q6URK4|ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1 1 78 8.0E-09
sp|Q8BG05|ROA3_MOUSE Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1 1 78 8.0E-09
sp|Q5ZI72|HNRDL_CHICK Heterogeneous nuclear ribonucleoprotein D-like OS=Gallus gallus GN=HNRNPDL PE=2 SV=1 3 73 8.0E-09
sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP4 PE=1 SV=1 1 78 8.0E-09
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 4 82 8.0E-09
sp|Q9ZR39|U2A2A_NICPL Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1 3 79 8.0E-09
sp|Q9CZ96|ZCRB1_MOUSE Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Mus musculus GN=Zcrb1 PE=1 SV=1 2 106 8.0E-09
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 2 78 8.0E-09
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 4 78 9.0E-09
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 4 78 9.0E-09
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 4 78 9.0E-09
sp|Q6MFP4|EIF3G_NEUCR Eukaryotic translation initiation factor 3 subunit G OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eif3g PE=3 SV=2 1 78 9.0E-09
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 1 78 1.0E-08
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 1 100 1.0E-08
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 1 78 1.0E-08
sp|Q9M9G6|CTF64_ARATH Cleavage stimulating factor 64 OS=Arabidopsis thaliana GN=CSTF64 PE=1 SV=1 4 93 1.0E-08
sp|Q9Z130|HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus GN=Hnrnpdl PE=1 SV=1 3 73 1.0E-08
sp|C1BY64|NCBP2_ESOLU Nuclear cap-binding protein subunit 2 OS=Esox lucius GN=ncbp2 PE=2 SV=1 4 108 1.0E-08
sp|Q20870|DAZ1_CAEEL DAZ protein 1 OS=Caenorhabditis elegans GN=daz-1 PE=2 SV=3 2 126 1.0E-08
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 4 78 1.0E-08
sp|Q6DES0|NCBP2_XENTR Nuclear cap-binding protein subunit 2 OS=Xenopus tropicalis GN=ncbp2 PE=2 SV=1 4 107 1.0E-08
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 4 78 1.0E-08
sp|Q64368|DAZL_MOUSE Deleted in azoospermia-like OS=Mus musculus GN=Dazl PE=1 SV=1 2 175 1.0E-08
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 4 82 1.0E-08
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 2 84 1.0E-08
sp|Q2H0U6|EIF3G_CHAGB Eukaryotic translation initiation factor 3 subunit G OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF35 PE=3 SV=1 1 79 1.0E-08
sp|Q2QKB4|U2A2B_WHEAT Splicing factor U2af large subunit B OS=Triticum aestivum GN=U2AF65B PE=2 SV=1 2 79 1.0E-08
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 2 79 2.0E-08
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 1 78 2.0E-08
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 1 78 2.0E-08
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 1 78 2.0E-08
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 1 50 2.0E-08
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 3 73 2.0E-08
sp|Q499V6|ZCRB1_RAT Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Rattus norvegicus GN=Zcrb1 PE=2 SV=1 2 106 2.0E-08
sp|Q08473|SQD_DROME RNA-binding protein squid OS=Drosophila melanogaster GN=sqd PE=1 SV=3 3 51 2.0E-08
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 2 84 2.0E-08
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 4 78 2.0E-08
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 2 78 2.0E-08
sp|B4M205|NCB2A_DROVI Nuclear cap-binding protein subunit 2-A OS=Drosophila virilis GN=Cbp20-A PE=3 SV=1 2 116 2.0E-08
sp|B0BN49|RBMX2_RAT RNA-binding motif protein, X-linked 2 OS=Rattus norvegicus GN=Rbmx2 PE=2 SV=1 4 76 2.0E-08
sp|B5G279|NCBP2_TAEGU Nuclear cap-binding protein subunit 2 OS=Taeniopygia guttata GN=NCBP2 PE=2 SV=1 2 107 2.0E-08
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 2 84 2.0E-08
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 2 84 2.0E-08
sp|Q2QKB3|U2A2A_WHEAT Splicing factor U2af large subunit A OS=Triticum aestivum GN=U2AF65A PE=2 SV=1 2 79 2.0E-08
sp|Q9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens GN=RBMX2 PE=1 SV=2 4 80 2.0E-08
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 4 82 2.0E-08
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 4 82 2.0E-08
sp|O64571|UBA1C_ARATH UBP1-associated proteins 1C OS=Arabidopsis thaliana GN=UBA1C PE=3 SV=2 4 60 2.0E-08
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 2 78 2.0E-08
sp|Q54KR9|NCBP2_DICDI Nuclear cap-binding protein subunit 2 OS=Dictyostelium discoideum GN=ncbp2 PE=3 SV=1 2 112 2.0E-08
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 2 84 3.0E-08
sp|P52299|NCBP2_XENLA Nuclear cap-binding protein subunit 2 OS=Xenopus laevis GN=ncbp2 PE=2 SV=2 4 107 3.0E-08
sp|O23212|U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana GN=U2AF65A PE=2 SV=2 2 79 3.0E-08
sp|Q293V6|NCBP2_DROPS Nuclear cap-binding protein subunit 2 OS=Drosophila pseudoobscura pseudoobscura GN=Cbp20 PE=3 SV=1 2 116 3.0E-08
sp|B4GLK8|NCBP2_DROPE Nuclear cap-binding protein subunit 2 OS=Drosophila persimilis GN=Cbp20 PE=3 SV=1 2 116 3.0E-08
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 2 78 3.0E-08
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 2 78 3.0E-08
sp|B4KCD5|NCBP2_DROMO Nuclear cap-binding protein subunit 2 OS=Drosophila mojavensis GN=Cbp20 PE=3 SV=1 2 116 3.0E-08
sp|Q7TSY6|CELF4_MOUSE CUGBP Elav-like family member 4 OS=Mus musculus GN=Celf4 PE=1 SV=2 3 91 3.0E-08
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 2 78 3.0E-08
sp|Q5NVC8|CELF4_PONAB CUGBP Elav-like family member 4 OS=Pongo abelii GN=CELF4 PE=2 SV=2 3 91 3.0E-08
sp|Q9BZC1|CELF4_HUMAN CUGBP Elav-like family member 4 OS=Homo sapiens GN=CELF4 PE=1 SV=1 3 91 3.0E-08
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 4 82 4.0E-08
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 4 82 4.0E-08
sp|B4NB54|NCBP2_DROWI Nuclear cap-binding protein subunit 2 OS=Drosophila willistoni GN=Cbp20 PE=3 SV=1 4 116 4.0E-08
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 2 78 4.0E-08
sp|O57437|DAZLA_XENLA Deleted in azoospermia-like-A OS=Xenopus laevis GN=dazl-a PE=1 SV=1 2 75 4.0E-08
sp|Q8L716|U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2 2 78 4.0E-08
sp|P17133|RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster GN=snRNP-U1-70K PE=1 SV=2 4 76 4.0E-08
sp|Q84TH4|SR45A_ARATH Serine/arginine-rich splicing factor SR45a OS=Arabidopsis thaliana GN=SR45A PE=1 SV=1 4 78 4.0E-08
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 4 82 4.0E-08
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 3 85 4.0E-08
sp|Q1RMR2|RU17_BOVIN U1 small nuclear ribonucleoprotein 70 kDa OS=Bos taurus GN=SNRNP70 PE=2 SV=1 1 76 5.0E-08
sp|Q4V7Y4|DAZLB_XENLA Deleted in azoospermia-like-B OS=Xenopus laevis GN=dazl-b PE=2 SV=2 2 75 5.0E-08
sp|Q0V9L3|CELF4_XENTR CUGBP Elav-like family member 4 OS=Xenopus tropicalis GN=celf4 PE=2 SV=1 3 88 5.0E-08
sp|Q5ZKR5|NCBP2_CHICK Nuclear cap-binding protein subunit 2 OS=Gallus gallus GN=NCBP2 PE=2 SV=1 2 107 5.0E-08
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 2 78 5.0E-08
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 4 80 5.0E-08
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 2 78 5.0E-08
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 2 78 5.0E-08
sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens GN=SNRNP70 PE=1 SV=2 1 76 5.0E-08
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 3 76 6.0E-08
sp|Q62376|RU17_MOUSE U1 small nuclear ribonucleoprotein 70 kDa OS=Mus musculus GN=Snrnp70 PE=1 SV=2 1 76 6.0E-08
sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 3 78 7.0E-08
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 4 75 7.0E-08
sp|Q8LFS6|BRN1L_ARATH RNA-binding protein BRN1 OS=Arabidopsis thaliana GN=BRN1 PE=2 SV=1 2 82 7.0E-08
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 2 79 7.0E-08
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 2 78 7.0E-08
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 1 78 8.0E-08
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 1 78 8.0E-08
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 1 78 8.0E-08
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 1 78 8.0E-08
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 4 75 8.0E-08
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 4 75 8.0E-08
sp|Q09511|RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans GN=rsp-4 PE=3 SV=1 1 75 8.0E-08
sp|B3LYP1|NCBP2_DROAN Nuclear cap-binding protein subunit 2 OS=Drosophila ananassae GN=Cbp20 PE=3 SV=1 2 116 8.0E-08
sp|B4LZ88|NCB2B_DROVI Nuclear cap-binding protein subunit 2B OS=Drosophila virilis GN=Cbp20-B PE=3 SV=1 2 116 8.0E-08
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 2 84 8.0E-08
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 1 50 9.0E-08
sp|B4JUT1|NCBP2_DROGR Nuclear cap-binding protein subunit 2 OS=Drosophila grimshawi GN=Cbp20 PE=3 SV=1 2 116 9.0E-08
sp|O80678|UBA2B_ARATH UBP1-associated protein 2B OS=Arabidopsis thaliana GN=UBA2B PE=2 SV=1 3 60 9.0E-08
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 3 81 9.0E-08
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 1 78 1.0E-07
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 1 78 1.0E-07
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 1 78 1.0E-07
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 4 75 1.0E-07
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 4 75 1.0E-07
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 4 75 1.0E-07
sp|O04425|FCA_ARATH Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 3 65 1.0E-07
sp|B3P0D7|NCBP2_DROER Nuclear cap-binding protein subunit 2 OS=Drosophila erecta GN=Cbp20 PE=3 SV=1 2 116 1.0E-07
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 4 75 1.0E-07
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 2 84 1.0E-07
sp|Q13148|TADBP_HUMAN TAR DNA-binding protein 43 OS=Homo sapiens GN=TARDBP PE=1 SV=1 2 52 1.0E-07
sp|Q5RC41|RBM14_PONAB RNA-binding protein 14 OS=Pongo abelii GN=RBM14 PE=2 SV=1 3 85 1.0E-07
sp|Q8C2Q3|RBM14_MOUSE RNA-binding protein 14 OS=Mus musculus GN=Rbm14 PE=1 SV=1 3 85 1.0E-07
sp|Q5R5W2|TADBP_PONAB TAR DNA-binding protein 43 OS=Pongo abelii GN=TARDBP PE=2 SV=1 2 52 1.0E-07
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 4 94 1.0E-07
sp|Q96PK6|RBM14_HUMAN RNA-binding protein 14 OS=Homo sapiens GN=RBM14 PE=1 SV=2 3 85 1.0E-07
sp|Q5EA36|RBM14_BOVIN RNA-binding protein 14 OS=Bos taurus GN=RBM14 PE=2 SV=1 3 85 1.0E-07
sp|Q177H0|NCBP2_AEDAE Nuclear cap-binding protein subunit 2 OS=Aedes aegypti GN=Cbp20 PE=3 SV=1 2 107 1.0E-07
sp|B4QV17|NCBP2_DROSI Nuclear cap-binding protein subunit 2 OS=Drosophila simulans GN=Cbp20 PE=3 SV=1 2 116 1.0E-07
sp|B4IBA4|NCBP2_DROSE Nuclear cap-binding protein subunit 2 OS=Drosophila sechellia GN=Cbp20 PE=3 SV=1 2 116 1.0E-07
sp|Q9V3L6|NCBP2_DROME Nuclear cap-binding protein subunit 2 OS=Drosophila melanogaster GN=Cbp20 PE=1 SV=1 2 116 1.0E-07
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 1 84 1.0E-07
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 4 75 1.0E-07
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 4 75 1.0E-07
sp|Q804A9|DAZL_CHICK Deleted in azoospermia-like OS=Gallus gallus GN=DAZL PE=2 SV=1 2 66 1.0E-07
sp|B4PL68|NCBP2_DROYA Nuclear cap-binding protein subunit 2 OS=Drosophila yakuba GN=Cbp20 PE=3 SV=1 2 116 1.0E-07
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 4 139 1.0E-07
sp|Q00539|NAM8_YEAST Protein NAM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM8 PE=1 SV=2 2 75 1.0E-07
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 3 78 2.0E-07
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 4 75 2.0E-07
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 2 86 2.0E-07
sp|Q9IBD1|CELF3_DANRE CUGBP Elav-like family member 3 OS=Danio rerio GN=celf3 PE=2 SV=2 3 64 2.0E-07
sp|Q7SZT7|ELAV4_XENLA ELAV-like protein 4 OS=Xenopus laevis GN=elavl4 PE=2 SV=1 4 75 2.0E-07
sp|A4QNI8|ELAV4_XENTR ELAV-like protein 4 OS=Xenopus tropicalis GN=elavl4 PE=2 SV=1 4 75 2.0E-07
sp|Q7QCB6|NCBP2_ANOGA Nuclear cap-binding protein subunit 2 OS=Anopheles gambiae GN=Cbp20 PE=3 SV=3 2 107 2.0E-07
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 4 83 2.0E-07
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 4 75 2.0E-07
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 2 78 2.0E-07
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 2 78 2.0E-07
sp|Q4R535|CELF4_MACFA CUGBP Elav-like family member 4 OS=Macaca fascicularis GN=CELF4 PE=2 SV=1 3 85 2.0E-07
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 4 79 2.0E-07
sp|Q95192|DAZL_MACFA Deleted in azoospermia-like OS=Macaca fascicularis GN=DAZL PE=2 SV=3 2 75 2.0E-07
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 2 84 2.0E-07
sp|Q921F2|TADBP_MOUSE TAR DNA-binding protein 43 OS=Mus musculus GN=Tardbp PE=1 SV=1 2 52 2.0E-07
sp|A0JM51|CELF5_XENTR CUGBP Elav-like family member 5 OS=Xenopus tropicalis GN=celf5 PE=2 SV=1 3 86 2.0E-07
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 2 78 2.0E-07
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 2 78 2.0E-07
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 2 78 2.0E-07
sp|Q9SEU4|SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana GN=SCL33 PE=1 SV=1 2 81 2.0E-07
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 2 78 2.0E-07
sp|Q92904|DAZL_HUMAN Deleted in azoospermia-like OS=Homo sapiens GN=DAZL PE=1 SV=1 2 75 2.0E-07
sp|Q66II8|RU17_XENTR U1 small nuclear ribonucleoprotein 70 kDa OS=Xenopus tropicalis GN=snrnp70 PE=2 SV=1 4 76 2.0E-07
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 2 149 3.0E-07
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 1 78 3.0E-07
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 1 90 3.0E-07
sp|Q02926|RB97D_DROME Ribonucleoprotein RB97D OS=Drosophila melanogaster GN=Rb97D PE=2 SV=1 1 60 3.0E-07
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 18 78 3.0E-07
sp|A7EWN6|EIF3G_SCLS1 Eukaryotic translation initiation factor 3 subunit G OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tif35 PE=3 SV=1 1 76 3.0E-07
sp|Q5ZLN5|TADBP_CHICK TAR DNA-binding protein 43 OS=Gallus gallus GN=TARDBP PE=2 SV=1 2 71 3.0E-07
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 1 73 3.0E-07
sp|A6SGN8|EIF3G_BOTFB Eukaryotic translation initiation factor 3 subunit G OS=Botryotinia fuckeliana (strain B05.10) GN=tif35 PE=3 SV=1 1 76 3.0E-07
sp|Q9FMG4|SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana GN=SC35 PE=1 SV=1 4 75 3.0E-07
sp|A4RHN3|EIF3G_MAGO7 Eukaryotic translation initiation factor 3 subunit G OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF35 PE=3 SV=1 1 76 3.0E-07
sp|Q8CIN6|CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus GN=Celf3 PE=2 SV=1 3 85 3.0E-07
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 3 79 3.0E-07
sp|Q5SZQ8|CELF3_HUMAN CUGBP Elav-like family member 3 OS=Homo sapiens GN=CELF3 PE=1 SV=1 3 85 3.0E-07
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 3 76 4.0E-07
sp|Q28521|ROA1_MACMU Heterogeneous nuclear ribonucleoprotein A1 OS=Macaca mulatta GN=HNRNPA1 PE=2 SV=3 1 78 4.0E-07
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 1 82 4.0E-07
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 1 82 4.0E-07
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 1 82 4.0E-07
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 1 82 4.0E-07
sp|Q08E07|CELF3_BOVIN CUGBP Elav-like family member 3 OS=Bos taurus GN=CELF3 PE=2 SV=1 3 85 4.0E-07
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 2 78 4.0E-07
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 1 75 4.0E-07
sp|A2SW84|NCBP2_SINCH Nuclear cap-binding protein subunit 2 OS=Siniperca chuatsi GN=ncbp2 PE=2 SV=1 4 105 4.0E-07
sp|Q8IUH3|RBM45_HUMAN RNA-binding protein 45 OS=Homo sapiens GN=RBM45 PE=1 SV=1 1 105 4.0E-07
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 2 78 4.0E-07
sp|Q24207|BOULE_DROME Protein boule OS=Drosophila melanogaster GN=bol PE=2 SV=1 2 83 5.0E-07
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 2 78 5.0E-07
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 4 82 5.0E-07
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 2 84 5.0E-07
sp|Q9IBD1|CELF3_DANRE CUGBP Elav-like family member 3 OS=Danio rerio GN=celf3 PE=2 SV=2 3 82 6.0E-07
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 2 84 6.0E-07
sp|Q44560|RBPA_NOSS1 Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 4 83 6.0E-07
sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 4 76 6.0E-07
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 4 107 6.0E-07
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 4 107 6.0E-07
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 4 79 6.0E-07
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 1 78 7.0E-07
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 4 75 7.0E-07
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 1 82 7.0E-07
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 4 79 7.0E-07
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 4 79 7.0E-07
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 4 75 8.0E-07
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 4 75 8.0E-07
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 2 84 8.0E-07
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 2 66 8.0E-07
sp|Q6DGV1|CELF4_DANRE CUGBP Elav-like family member 4 OS=Danio rerio GN=celf4 PE=2 SV=1 3 59 8.0E-07
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 4 75 9.0E-07
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 1 75 9.0E-07
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 2 84 9.0E-07
sp|Q0U6E7|EIF3G_PHANO Eukaryotic translation initiation factor 3 subunit G OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TIF35 PE=3 SV=2 4 76 9.0E-07
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 2 66 9.0E-07
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 4 75 1.0E-06
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 4 75 1.0E-06
sp|B0W939|NCBP2_CULQU Nuclear cap-binding protein subunit 2 OS=Culex quinquefasciatus GN=Cbp20 PE=3 SV=1 2 108 1.0E-06
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 2 84 1.0E-06
sp|Q9YGW7|DAZL_DANRE Deleted in azoospermia-like OS=Danio rerio GN=dazl PE=1 SV=1 2 132 1.0E-06
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 2 101 1.0E-06
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 1 75 1.0E-06
sp|Q28F51|TADBP_XENTR TAR DNA-binding protein 43 OS=Xenopus tropicalis GN=tardbp PE=2 SV=1 2 71 1.0E-06
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 3 78 2.0E-06
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 3 76 2.0E-06
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 1 75 2.0E-06
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 4 76 2.0E-06
sp|Q9LHP2|SL30A_ARATH Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana GN=SCL30A PE=1 SV=1 2 81 2.0E-06
sp|Q6IQ97|RBM41_DANRE RNA-binding protein 4.1 OS=Danio rerio GN=rbm4.1 PE=1 SV=1 2 102 2.0E-06
sp|Q1JQ73|ELV1A_XENLA ELAV-like protein 1-A OS=Xenopus laevis GN=elavl1-a PE=1 SV=1 4 75 2.0E-06
sp|Q08920|NCBP2_YEAST Nuclear cap-binding protein subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBC2 PE=1 SV=1 2 108 2.0E-06
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 1 84 2.0E-06
sp|Q8N6W0|CELF5_HUMAN CUGBP Elav-like family member 5 OS=Homo sapiens GN=CELF5 PE=1 SV=1 3 86 2.0E-06
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 3 78 2.0E-06
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 2 66 2.0E-06
sp|P26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens GN=U2AF2 PE=1 SV=4 3 79 2.0E-06
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 1 75 2.0E-06
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 4 78 2.0E-06
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 3 75 2.0E-06
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 1 75 3.0E-06
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 4 75 3.0E-06
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 4 75 3.0E-06
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 2 78 3.0E-06
sp|Q6GLW1|THO4B_XENLA THO complex subunit 4-B OS=Xenopus laevis GN=alyref-b PE=2 SV=1 3 75 3.0E-06
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 1 75 3.0E-06
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 2 84 3.0E-06
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 1 75 3.0E-06
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 1 75 3.0E-06
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 4 75 3.0E-06
sp|P26369|U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3 3 79 3.0E-06
sp|Q8L3X8|SRC30_ARATH Serine/arginine-rich SC35-like splicing factor SCL30 OS=Arabidopsis thaliana GN=SCL30 PE=1 SV=1 4 84 3.0E-06
sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 4 76 3.0E-06
sp|Q8BHN5|RBM45_MOUSE RNA-binding protein 45 OS=Mus musculus GN=Rbm45 PE=1 SV=1 1 105 3.0E-06
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 2 84 3.0E-06
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 1 75 3.0E-06
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 4 127 3.0E-06
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 1 75 3.0E-06
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 1 75 4.0E-06
sp|Q9P383|NCBP2_SCHPO Nuclear cap-binding protein subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbc2 PE=3 SV=1 4 105 4.0E-06
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 2 66 4.0E-06
sp|Q5RBR8|IF4H_PONAB Eukaryotic translation initiation factor 4H OS=Pongo abelii GN=EIF4H PE=2 SV=1 5 180 4.0E-06
sp|Q5R8K3|SLIRP_PONAB SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Pongo abelii GN=SLIRP PE=3 SV=1 5 75 5.0E-06
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 1 84 5.0E-06
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 1 84 5.0E-06
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 1 84 5.0E-06
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 1 84 5.0E-06
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 1 84 5.0E-06
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 1 84 5.0E-06
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 4 78 5.0E-06
sp|Q8VE97|SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus GN=Srsf4 PE=2 SV=1 1 107 5.0E-06
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 4 124 5.0E-06
sp|Q5XI72|IF4H_RAT Eukaryotic translation initiation factor 4H OS=Rattus norvegicus GN=Eif4h PE=1 SV=1 5 180 6.0E-06
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 1 82 6.0E-06
sp|Q8L773|THO4A_ARATH THO complex subunit 4A OS=Arabidopsis thaliana GN=ALY1 PE=1 SV=1 2 76 7.0E-06
sp|Q05AT9|U1SBP_XENLA U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Xenopus laevis GN=snrnp35 PE=2 SV=1 4 85 7.0E-06
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 2 91 9.0E-06
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 4 153 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2156
MSKLFIGGLAWHTEEATLRQKFEEFGAVEEAVVVKDRDTGRSRGFGFVRYTQEGDAQNAIATMNNVEFDGRTIRV
DKASDNGPRGGYGGGRGGAPGYGGRGGYGPPMSYSMPPGPPYAVPPPQMYAPMNYSRGYPPQHGYAVGPQGYGGP
QYGYANPGPQQPSAMHPQQQPPPAHIQQQQPPPPHQGGRGY*
Coding >OphauB2|2156
ATGTCTAAGCTCTTTATTGGTGGCCTAGCTTGGCATACTGAAGAGGCTACTCTTCGCCAAAAATTCGAGGAGTTT
GGAGCTGTAGAAGAAGCGGTCGTGGTTAAGGACCGAGACACTGGTCGCAGCCGTGGCTTTGGCTTTGTGCGATAT
ACGCAAGAGGGAGATGCTCAGAATGCAATTGCCACCATGAACAACGTCGAATTTGACGGCCGAACAATTCGCGTC
GACAAGGCGTCGGACAATGGCCCGCGTGGAGGCTACGGCGGTGGCCGTGGCGGCGCTCCTGGCTATGGCGGGCGA
GGCGGCTACGGGCCCCCCATGTCTTATAGCATGCCACCTGGTCCTCCCTATGCTGTCCCTCCGCCCCAGATGTAC
GCGCCCATGAATTACTCACGCGGCTATCCTCCACAGCATGGATACGCCGTTGGCCCACAGGGATATGGTGGGCCG
CAGTATGGATATGCGAACCCCGGCCCTCAACAGCCATCGGCGATGCATCCTCAGCAACAGCCGCCCCCGGCTCAT
ATCCAGCAGCAGCAACCGCCTCCGCCTCACCAGGGCGGTCGAGGATACTAG
Transcript >OphauB2|2156
ATGTCTAAGCTCTTTATTGGTGGCCTAGCTTGGCATACTGAAGAGGCTACTCTTCGCCAAAAATTCGAGGAGTTT
GGAGCTGTAGAAGAAGCGGTCGTGGTTAAGGACCGAGACACTGGTCGCAGCCGTGGCTTTGGCTTTGTGCGATAT
ACGCAAGAGGGAGATGCTCAGAATGCAATTGCCACCATGAACAACGTCGAATTTGACGGCCGAACAATTCGCGTC
GACAAGGCGTCGGACAATGGCCCGCGTGGAGGCTACGGCGGTGGCCGTGGCGGCGCTCCTGGCTATGGCGGGCGA
GGCGGCTACGGGCCCCCCATGTCTTATAGCATGCCACCTGGTCCTCCCTATGCTGTCCCTCCGCCCCAGATGTAC
GCGCCCATGAATTACTCACGCGGCTATCCTCCACAGCATGGATACGCCGTTGGCCCACAGGGATATGGTGGGCCG
CAGTATGGATATGCGAACCCCGGCCCTCAACAGCCATCGGCGATGCATCCTCAGCAACAGCCGCCCCCGGCTCAT
ATCCAGCAGCAGCAACCGCCTCCGCCTCACCAGGGCGGTCGAGGATACTAG
Gene >OphauB2|2156
ATGTCTAAGCTCTTTATTGGGTGAGTCGCTCAACCTGCCAAAGCAAGCTTTGCCCTCGCTCTCCTTGAGCGCACA
CGTCTTGTCATGCTCGCGCGGCTTGCTCCCCTCTGGCCTTTATTCTCGCACATGGACATGACTAGCGCGTTGGCG
TATTCTCCCGTCTGCCGCTGGGAAAAGAGTCAATCAGCATGTGTGTGTATGCTGATTTCTGGGGCAGTGGCCTAG
CTTGGCATACTGAAGAGGCTACTCTTCGCCAAAAATTCGAGGAGTTTGGAGCTGTAGAAGAAGCGGTACGTCTGG
CGCCCTCTTTTTTTTCTTCTCGTCATTGTTTGCTTGTCGAGTTTATTGCGCATGTCTCACCACAGCTTGTTGTTG
CTGGTTTCTGGTTACCCTTGTGTGCGTGAGAGCTCTCTTCTAATTCAGCTTTCGTCGGTCCGAGCATAAAGGTCG
TGGTTAAGGACCGAGACACTGGTCGCAGCCGTGGCTTTGGCTTTGTGCGATATACGCAAGAGGGAGATGCTCAGA
ATGCAATTGCCACCATGAACAACGTCGAGTACGATCTCCATGCCGTTTTCTAATCGTGTTGCTGCGGACCGGCTT
CGTCTCTCCTAGGGCCCTGCTTCTTACTCTATTGTGCAGATTTGACGGCCGAACAATTCGCGTCGACAAGGCGTC
GGACAATGGCCCGCGTGGAGGCTACGGCGGTGGCCGTGGCGGCGCTCCTGGCTATGGCGGGCGAGGCGGCTACGG
GCCCCCCATGTCTTATAGCATGCCACCTGGTCCTCCCTATGCTGTCCCTCCGCCCCAGATGTACGCGCCCATGAA
TTACTCACGCGGCTATCCTCCACAGCATGGATACGCCGTTGGCCCACAGGGTAATGAGTCTTGTTTGCTCCTCTT
GGCCGGCCACAGTATACATTGCTAAGCGCGGCGTACAGGATATGGTGGGCCGCAGTATGGATATGCGAACCCCGG
CCCTCAACAGCCATCGGCGATGCATCCTCAGCAACAGCCGCCCCCGGCTCATATCCAGCAGCAGCAACCGCCTCC
GCCTCACCAGGGCGGTCGAGGATACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail