Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2154
Gene name
LocationContig_165:26627..27518
Strand-
Gene length (bp)891
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 1.0E-07 102 126
PF13499 EF-hand_7 EF-hand domain pair 2.1E-09 65 125
PF13833 EF-hand_8 EF-hand domain pair 6.6E-08 77 126
PF13833 EF-hand_8 EF-hand domain pair 8.6E-03 134 156
PF13833 EF-hand_8 EF-hand domain pair 6.8E-03 144 189
PF13202 EF-hand_5 EF hand 2.5E-02 106 122
PF13202 EF-hand_5 EF hand 1.4E-03 135 153
PF13202 EF-hand_5 EF hand 3.0E-02 200 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P12815|PDCD6_MOUSE Programmed cell death protein 6 OS=Mus musculus GN=Pdcd6 PE=1 SV=2 65 225 2.0E-45
sp|O75340|PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1 65 225 3.0E-45
sp|Q94743|SORCN_SCHJA Sorcin OS=Schistosoma japonicum PE=2 SV=1 64 222 5.0E-43
sp|Q641Z8|PEF1_RAT Peflin OS=Rattus norvegicus GN=Pef1 PE=2 SV=1 23 222 2.0E-40
sp|Q5PQ53|PEF1_XENLA Peflin OS=Xenopus laevis GN=pef1 PE=1 SV=1 38 228 4.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P12815|PDCD6_MOUSE Programmed cell death protein 6 OS=Mus musculus GN=Pdcd6 PE=1 SV=2 65 225 2.0E-45
sp|O75340|PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1 65 225 3.0E-45
sp|Q94743|SORCN_SCHJA Sorcin OS=Schistosoma japonicum PE=2 SV=1 64 222 5.0E-43
sp|Q641Z8|PEF1_RAT Peflin OS=Rattus norvegicus GN=Pef1 PE=2 SV=1 23 222 2.0E-40
sp|Q5PQ53|PEF1_XENLA Peflin OS=Xenopus laevis GN=pef1 PE=1 SV=1 38 228 4.0E-40
sp|Q8BFY6|PEF1_MOUSE Peflin OS=Mus musculus GN=Pef1 PE=1 SV=1 32 222 5.0E-40
sp|Q9UBV8|PEF1_HUMAN Peflin OS=Homo sapiens GN=PEF1 PE=1 SV=1 60 222 5.0E-39
sp|Q6DC93|PEF1_DANRE Peflin OS=Danio rerio GN=pef1 PE=2 SV=1 62 228 2.0E-36
sp|Q6P069|SORCN_MOUSE Sorcin OS=Mus musculus GN=Sri PE=1 SV=1 59 225 2.0E-27
sp|Q8W4L0|CML49_ARATH Probable calcium-binding protein CML49 OS=Arabidopsis thaliana GN=CML49 PE=2 SV=1 62 225 2.0E-27
sp|Q5R4U9|SORCN_PONAB Sorcin OS=Pongo abelii GN=SRI PE=2 SV=1 59 225 8.0E-27
sp|P30626|SORCN_HUMAN Sorcin OS=Homo sapiens GN=SRI PE=1 SV=1 59 225 8.0E-27
sp|P05044|SORCN_CRIGR Sorcin OS=Cricetulus griseus GN=SRI PE=1 SV=1 78 225 1.0E-26
sp|Q9FYE4|CML50_ARATH Probable calcium-binding protein CML50 OS=Arabidopsis thaliana GN=CML50 PE=2 SV=1 62 225 1.0E-26
sp|Q8VC88|GRAN_MOUSE Grancalcin OS=Mus musculus GN=Gca PE=1 SV=1 61 225 4.0E-26
sp|P28676|GRAN_HUMAN Grancalcin OS=Homo sapiens GN=GCA PE=1 SV=2 33 225 2.0E-23
sp|Q5RAI6|GRAN_PONAB Grancalcin OS=Pongo abelii GN=GCA PE=2 SV=1 33 225 1.0E-22
sp|P53238|PEF1_YEAST Peflin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEF1 PE=1 SV=2 7 225 2.0E-22
sp|P13135|CPNS1_BOVIN Calpain small subunit 1 OS=Bos taurus GN=CAPNS1 PE=2 SV=1 96 221 6.0E-19
sp|P04574|CPNS1_PIG Calpain small subunit 1 OS=Sus scrofa GN=CAPNS1 PE=1 SV=1 20 221 1.0E-18
sp|P04632|CPNS1_HUMAN Calpain small subunit 1 OS=Homo sapiens GN=CAPNS1 PE=1 SV=1 20 221 4.0E-18
sp|P06813|CPNS1_RABIT Calpain small subunit 1 OS=Oryctolagus cuniculus GN=CAPNS1 PE=1 SV=1 20 221 6.0E-18
sp|Q96L46|CPNS2_HUMAN Calpain small subunit 2 OS=Homo sapiens GN=CAPNS2 PE=2 SV=2 96 221 8.0E-18
sp|O88456|CPNS1_MOUSE Calpain small subunit 1 OS=Mus musculus GN=Capns1 PE=1 SV=1 96 221 1.0E-17
sp|Q9D7J7|CPNS2_MOUSE Calpain small subunit 2 OS=Mus musculus GN=Capns2 PE=2 SV=1 21 221 1.0E-17
sp|Q9ZQH1|CML48_ARATH Probable calcium-binding protein CML48 OS=Arabidopsis thaliana GN=CML48 PE=2 SV=2 1 225 2.0E-17
sp|Q64537|CPNS1_RAT Calpain small subunit 1 OS=Rattus norvegicus GN=Capns1 PE=1 SV=3 20 221 2.0E-17
sp|Q11002|CANA_DROME Calpain-A OS=Drosophila melanogaster GN=CalpA PE=1 SV=2 85 225 2.0E-16
sp|Q92177|CAN3_CHICK Calpain-3 OS=Gallus gallus GN=CAPN3 PE=2 SV=1 96 221 9.0E-16
sp|Q9VT65|CANB_DROME Calpain-B OS=Drosophila melanogaster GN=CalpB PE=1 SV=2 43 225 2.0E-15
sp|P20807|CAN3_HUMAN Calpain-3 OS=Homo sapiens GN=CAPN3 PE=1 SV=2 36 222 2.0E-15
sp|Q9GLG7|CAN3_MACFA Calpain-3 OS=Macaca fascicularis GN=CAPN3 PE=2 SV=1 36 222 7.0E-15
sp|Q64691|CAN3_MOUSE Calpain-3 OS=Mus musculus GN=Capn3 PE=2 SV=2 36 222 1.0E-14
sp|P43368|CAN3_PIG Calpain-3 OS=Sus scrofa GN=CAPN3 PE=2 SV=2 39 222 1.0E-14
sp|P16259|CAN3_RAT Calpain-3 OS=Rattus norvegicus GN=Capn3 PE=2 SV=1 36 222 3.0E-14
sp|P06815|CAN1_RABIT Calpain-1 catalytic subunit (Fragment) OS=Oryctolagus cuniculus GN=CAPN1 PE=1 SV=1 51 214 8.0E-14
sp|P97571|CAN1_RAT Calpain-1 catalytic subunit OS=Rattus norvegicus GN=Capn1 PE=1 SV=1 36 222 1.0E-13
sp|O35350|CAN1_MOUSE Calpain-1 catalytic subunit OS=Mus musculus GN=Capn1 PE=1 SV=1 36 222 1.0E-13
sp|P51186|CAN3_BOVIN Calpain-3 OS=Bos taurus GN=CAPN3 PE=2 SV=2 96 222 1.0E-13
sp|Q9TTH8|CAN3_SHEEP Calpain-3 OS=Ovis aries GN=CAPN3 PE=2 SV=1 96 222 2.0E-13
sp|Q27970|CAN1_BOVIN Calpain-1 catalytic subunit OS=Bos taurus GN=CAPN1 PE=1 SV=3 51 222 4.0E-13
sp|Q9GLG2|CAN1_MACFA Calpain-1 catalytic subunit OS=Macaca fascicularis GN=CAPN1 PE=2 SV=1 96 221 5.0E-13
sp|Q5NVS7|CAN1_PONAB Calpain-1 catalytic subunit OS=Pongo abelii GN=CAPN1 PE=2 SV=1 96 221 5.0E-13
sp|P07384|CAN1_HUMAN Calpain-1 catalytic subunit OS=Homo sapiens GN=CAPN1 PE=1 SV=1 96 221 6.0E-13
sp|P35750|CAN1_PIG Calpain-1 catalytic subunit OS=Sus scrofa GN=CAPN1 PE=2 SV=3 96 222 6.0E-13
sp|O14815|CAN9_HUMAN Calpain-9 OS=Homo sapiens GN=CAPN9 PE=1 SV=1 101 221 1.0E-12
sp|O08529|CAN2_MOUSE Calpain-2 catalytic subunit OS=Mus musculus GN=Capn2 PE=1 SV=4 96 222 3.0E-12
sp|Q95YL5|PEFA_DICDI Penta-EF hand domain-containing protein 1 OS=Dictyostelium discoideum GN=pefA PE=1 SV=1 69 216 3.0E-12
sp|Q92178|CAN2_CHICK Calpain-2 catalytic subunit OS=Gallus gallus GN=CAPN2 PE=2 SV=3 96 221 4.0E-12
sp|P06814|CAN2_RABIT Calpain-2 catalytic subunit (Fragment) OS=Oryctolagus cuniculus GN=CAPN2 PE=1 SV=1 96 222 1.0E-11
sp|Q07009|CAN2_RAT Calpain-2 catalytic subunit OS=Rattus norvegicus GN=Capn2 PE=1 SV=3 96 222 2.0E-11
sp|Q27971|CAN2_BOVIN Calpain-2 catalytic subunit OS=Bos taurus GN=CAPN2 PE=2 SV=2 96 222 2.0E-11
sp|Q9GLG1|CAN2_MACFA Calpain-2 catalytic subunit OS=Macaca fascicularis GN=CAPN2 PE=2 SV=3 96 222 2.0E-11
sp|P27730|CAN_SCHMA Calpain OS=Schistosoma mansoni PE=2 SV=1 52 221 2.0E-11
sp|P17655|CAN2_HUMAN Calpain-2 catalytic subunit OS=Homo sapiens GN=CAPN2 PE=1 SV=6 96 222 2.0E-11
sp|O35920|CAN9_RAT Calpain-9 OS=Rattus norvegicus GN=Capn9 PE=2 SV=2 50 222 3.0E-11
sp|P00789|CANX_CHICK Calpain-1 catalytic subunit OS=Gallus gallus PE=1 SV=2 96 221 3.0E-11
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 26 226 4.0E-11
sp|Q6J756|CAN11_MOUSE Calpain-11 OS=Mus musculus GN=Capn11 PE=1 SV=1 85 221 4.0E-11
sp|Q9D805|CAN9_MOUSE Calpain-9 OS=Mus musculus GN=Capn9 PE=2 SV=2 101 222 5.0E-11
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 26 213 4.0E-10
sp|Q4V8Q1|CAN11_RAT Calpain 11 OS=Rattus norvegicus GN=Capn11 PE=2 SV=2 96 221 5.0E-10
sp|P43367|CAN2_PIG Calpain-2 catalytic subunit (Fragment) OS=Sus scrofa GN=CAPN2 PE=2 SV=2 96 222 6.0E-10
sp|A6NHC0|CAN8_HUMAN Calpain-8 OS=Homo sapiens GN=CAPN8 PE=2 SV=3 96 225 1.0E-09
sp|Q78EJ9|CAN8_RAT Calpain-8 OS=Rattus norvegicus GN=Capn8 PE=2 SV=1 46 225 3.0E-09
sp|Q95YL4|PEFB_DICDI Penta-EF hand domain-containing protein 2 OS=Dictyostelium discoideum GN=pefB PE=1 SV=1 69 216 4.0E-09
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 69 195 4.0E-09
sp|Q91VA3|CAN8_MOUSE Calpain-8 OS=Mus musculus GN=Capn8 PE=1 SV=1 96 225 5.0E-09
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 26 213 7.0E-09
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 26 213 1.0E-08
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 69 208 2.0E-08
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 69 208 2.0E-08
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 83 213 4.0E-08
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 69 194 8.0E-08
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 69 190 9.0E-08
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 69 190 9.0E-08
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 69 190 9.0E-08
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 69 190 1.0E-07
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 69 190 1.0E-07
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 69 190 1.0E-07
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 69 190 1.0E-07
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 69 189 2.0E-07
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 69 194 2.0E-07
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 98 213 2.0E-07
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 98 216 2.0E-07
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 69 194 3.0E-07
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 69 189 4.0E-07
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 69 194 7.0E-07
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 69 194 7.0E-07
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 69 194 7.0E-07
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 69 190 7.0E-07
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 69 190 7.0E-07
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 69 188 9.0E-07
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 69 190 9.0E-07
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 69 194 1.0E-06
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 69 190 1.0E-06
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 133 214 1.0E-06
sp|Q9LE22|CML27_ARATH Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1 35 188 1.0E-06
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 69 194 2.0E-06
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 69 194 2.0E-06
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 69 194 2.0E-06
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 73 190 2.0E-06
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 69 194 2.0E-06
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 69 194 3.0E-06
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 69 194 3.0E-06
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 69 194 3.0E-06
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 69 194 3.0E-06
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 69 194 3.0E-06
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 69 194 3.0E-06
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 69 194 3.0E-06
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 69 194 3.0E-06
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 69 194 3.0E-06
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 69 194 3.0E-06
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 69 194 3.0E-06
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 69 194 3.0E-06
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 69 194 3.0E-06
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 69 194 3.0E-06
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 69 197 3.0E-06
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 69 194 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2154
MAYNRPYNPDALPRFAEPDAPAPSRYDSKPPPPIPKTASPPPERKHASRPPPSPALDAGKADPTLLPLFRAVDKD
ATGQLSEKELSAALVNGDWTAFDIQTIRMMIRMFDSDRNGTINFDEFCGLWSFLASWRTLFDRFDVDRSGNISLA
EFSDALVAFRYRLSPRFVELLFRTYDKRQEGVMSFDLFVQSCISLKRMTDVFKKYDNDRDGYITLSFEDFLSEIL
KQLK*
Coding >OphauB2|2154
ATGGCATATAATAGACCATACAACCCCGACGCTCTACCCAGATTCGCCGAACCAGACGCTCCCGCCCCGTCGCGA
TATGACTCCAAGCCTCCTCCGCCAATCCCAAAAACTGCGTCTCCTCCACCAGAGCGTAAACACGCCTCCCGTCCT
CCGCCGTCGCCCGCCCTCGATGCCGGCAAGGCTGATCCGACGCTCCTCCCCCTCTTTCGCGCAGTAGACAAGGAC
GCAACCGGCCAACTCTCGGAAAAGGAACTCTCAGCCGCCCTGGTCAATGGCGACTGGACCGCGTTTGATATCCAA
ACTATTCGCATGATGATTCGCATGTTTGACTCTGACCGCAACGGAACTATAAACTTTGACGAATTCTGCGGCCTC
TGGTCCTTTCTCGCTTCTTGGCGCACCCTCTTTGATCGCTTCGACGTGGACCGCAGCGGAAACATCTCCCTGGCG
GAATTCTCAGACGCCCTCGTCGCCTTTAGATATCGCCTTAGCCCCCGCTTCGTCGAGTTGCTCTTTCGCACCTAT
GATAAGCGCCAAGAGGGCGTCATGAGCTTCGACTTGTTTGTCCAGAGCTGTATTTCCCTAAAGCGCATGACGGAC
GTGTTTAAAAAGTATGACAATGATCGCGATGGCTACATTACCCTCAGCTTTGAAGACTTTTTGAGTGAGATTCTC
AAGCAGCTCAAATAA
Transcript >OphauB2|2154
ATGGCATATAATAGACCATACAACCCCGACGCTCTACCCAGATTCGCCGAACCAGACGCTCCCGCCCCGTCGCGA
TATGACTCCAAGCCTCCTCCGCCAATCCCAAAAACTGCGTCTCCTCCACCAGAGCGTAAACACGCCTCCCGTCCT
CCGCCGTCGCCCGCCCTCGATGCCGGCAAGGCTGATCCGACGCTCCTCCCCCTCTTTCGCGCAGTAGACAAGGAC
GCAACCGGCCAACTCTCGGAAAAGGAACTCTCAGCCGCCCTGGTCAATGGCGACTGGACCGCGTTTGATATCCAA
ACTATTCGCATGATGATTCGCATGTTTGACTCTGACCGCAACGGAACTATAAACTTTGACGAATTCTGCGGCCTC
TGGTCCTTTCTCGCTTCTTGGCGCACCCTCTTTGATCGCTTCGACGTGGACCGCAGCGGAAACATCTCCCTGGCG
GAATTCTCAGACGCCCTCGTCGCCTTTAGATATCGCCTTAGCCCCCGCTTCGTCGAGTTGCTCTTTCGCACCTAT
GATAAGCGCCAAGAGGGCGTCATGAGCTTCGACTTGTTTGTCCAGAGCTGTATTTCCCTAAAGCGCATGACGGAC
GTGTTTAAAAAGTATGACAATGATCGCGATGGCTACATTACCCTCAGCTTTGAAGACTTTTTGAGTGAGATTCTC
AAGCAGCTCAAATAA
Gene >OphauB2|2154
ATGGCATATAATAGACCATACAACCCCGACGCTCTACCCAGGTAACCGCCATATTTCCCATTCCTACCAAAACCC
CCCGCTAAGCCATTCTAGATTCGCCGAACCAGACGCTGTAACGCCTACCCGTCTACTTCTGCTAATCTCTTCTAA
CGTGCTCGTAGCCCGCCCCGTCGCGATATGACTCCAAGCCTCCTCCGCCAATCCCAAAAACTGCGTCTCCTCCAC
CAGAGCGTAAACACGCCTCCCGTCCTCCGCCGTCGCCCGCCCTCGATGCCGGCAAGGCTGATCCGACGCTCCTCC
CCCTCTTTCGCGCAGTAGACAAGGACGGTGCGTTTTTTTTTTCTCCCTTGTTCTCCCCAATCTTTGTAACCCTTG
CTTTCCTCCCTTTCTTCTCCCCCAAGCTTGTAACCCATGCTAACACACACAGCAACCGGCCAACTCTCGGAAAAG
GAACTCTCAGCCGCCCTGGTCAATGGCGACTGGACCGCGTTTGATATCCAAACTATTCGCATGATGATTCGCATG
TTTGACTCTGACCGCAACGGAACTATAAACTTTGACGAATTCTGCGGCCTCTGGTCCTTTCTCGCTTCTTGGCGC
ACCCTCTTTGATCGCTTCGACGTGGACCGCAGCGGAAACATCTCCCTGGCGGAATTCTCAGACGCCCTCGTCGCC
TTTAGATATCGCCTTAGCCCCCGCTTCGTCGAGTTGCTCTTTCGCACCTATGATAAGCGCCAAGAGGGCGTCATG
AGCTTCGACTTGTTTGTCCAGAGCTGTATTTCCCTAAAGCGCATGACGGACGTGTTTAAAAAGTATGACAATGAT
CGCGATGGCTACATTACCCTCAGCTTTGAAGACTTTTTGAGTGAGATTCTCAAGCAGCTCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail