Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2153
Gene name
LocationContig_165:25081..26359
Strand+
Gene length (bp)1278
Transcript length (bp)1278
Coding sequence length (bp)1278
Protein length (aa) 426

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13483 Lactamase_B_3 Beta-lactamase superfamily domain 4.0E-06 31 139

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2153
MALTIKQLNGDASFHLTLEPIQARSSSEQYHMLIDPWIAGPSSILHPKFSSTSHVEPACISSLRELPEPDVVIIS
HNRSSHCHEATLRQLAPKDTKTLILAVPAAARLIRSWNYFDKNKVKTLDRWEHPRKANRDTCYRIPVPSQLLGGG
DGEVTVSYISHRKRHPRGHHCAIGITYRPPTSESFAFWRQTATPPLTPSSTVSALPPRLPAARRFSKLNLPPSMS
WAANLGSQSPPGTPLGQTLRQTRPSACPSPHAQDRCVSVIFSPHGIPYSSLEPYATSHLLTEAALPLTALLHCFE
TVHSPWCLGSKGNSGIHTGQEIATALGARAWISTYDGNKIATGLAGRLTGKSNKYDSQQMQHMLRLVFEQAAKAG
TEPLVGRKKREDVIEILALKSGAQVTLTSEGIWSEPSAMASAPVAKHDGL*
Coding >OphauB2|2153
ATGGCGCTTACCATTAAGCAGCTCAATGGCGATGCCTCGTTTCATCTCACCCTGGAGCCCATTCAGGCCAGGTCG
TCATCTGAGCAATATCACATGCTCATTGACCCCTGGATCGCCGGACCCTCGAGCATCCTTCACCCCAAGTTTTCG
TCGACAAGCCATGTCGAGCCGGCCTGCATTTCGTCCCTCAGAGAGCTGCCAGAGCCAGATGTCGTCATAATCAGC
CACAATAGAAGTTCTCACTGCCATGAGGCGACTCTGCGCCAACTGGCGCCCAAAGACACCAAGACACTCATTCTC
GCCGTGCCCGCAGCTGCCCGCTTGATACGGAGCTGGAACTACTTTGACAAGAATAAAGTCAAGACTCTTGACCGC
TGGGAGCATCCGCGCAAAGCTAACCGAGACACGTGCTACCGAATCCCTGTTCCCTCGCAGCTTCTAGGCGGTGGC
GACGGAGAGGTGACAGTCTCGTATATTTCGCATCGCAAGCGCCATCCCAGAGGCCACCATTGTGCCATTGGCATA
ACCTATCGCCCCCCAACCTCGGAATCGTTTGCCTTTTGGCGCCAGACGGCGACGCCTCCCCTGACGCCCAGCTCC
ACCGTGTCGGCCTTGCCACCTCGACTGCCCGCAGCACGGCGCTTCTCCAAGCTAAACCTGCCCCCCTCAATGTCA
TGGGCCGCCAATTTGGGCTCACAGTCGCCTCCCGGAACGCCTCTTGGGCAAACGTTGCGACAGACACGCCCCTCG
GCATGTCCATCGCCACACGCACAAGACCGATGCGTCTCAGTCATCTTTTCGCCTCACGGCATTCCATATAGCAGC
CTCGAGCCCTATGCCACCTCGCACCTCCTCACCGAGGCTGCTCTGCCCCTGACGGCTCTGCTGCACTGTTTTGAA
ACGGTGCATAGCCCGTGGTGTCTTGGCAGCAAGGGCAACTCGGGCATCCACACTGGGCAAGAGATTGCCACTGCG
CTGGGAGCTCGAGCGTGGATCAGCACCTATGATGGAAACAAGATTGCTACAGGCCTAGCCGGCAGGCTCACGGGC
AAGAGCAACAAGTACGATTCGCAGCAAATGCAGCACATGCTACGTCTTGTGTTTGAGCAGGCAGCAAAGGCAGGC
ACAGAGCCTTTGGTTGGCAGGAAGAAACGGGAAGACGTTATTGAGATTCTCGCTCTCAAGTCTGGGGCTCAGGTG
ACGCTGACGAGCGAAGGCATATGGTCCGAGCCGTCAGCCATGGCGAGTGCTCCTGTGGCCAAGCACGACGGCTTG
TAA
Transcript >OphauB2|2153
ATGGCGCTTACCATTAAGCAGCTCAATGGCGATGCCTCGTTTCATCTCACCCTGGAGCCCATTCAGGCCAGGTCG
TCATCTGAGCAATATCACATGCTCATTGACCCCTGGATCGCCGGACCCTCGAGCATCCTTCACCCCAAGTTTTCG
TCGACAAGCCATGTCGAGCCGGCCTGCATTTCGTCCCTCAGAGAGCTGCCAGAGCCAGATGTCGTCATAATCAGC
CACAATAGAAGTTCTCACTGCCATGAGGCGACTCTGCGCCAACTGGCGCCCAAAGACACCAAGACACTCATTCTC
GCCGTGCCCGCAGCTGCCCGCTTGATACGGAGCTGGAACTACTTTGACAAGAATAAAGTCAAGACTCTTGACCGC
TGGGAGCATCCGCGCAAAGCTAACCGAGACACGTGCTACCGAATCCCTGTTCCCTCGCAGCTTCTAGGCGGTGGC
GACGGAGAGGTGACAGTCTCGTATATTTCGCATCGCAAGCGCCATCCCAGAGGCCACCATTGTGCCATTGGCATA
ACCTATCGCCCCCCAACCTCGGAATCGTTTGCCTTTTGGCGCCAGACGGCGACGCCTCCCCTGACGCCCAGCTCC
ACCGTGTCGGCCTTGCCACCTCGACTGCCCGCAGCACGGCGCTTCTCCAAGCTAAACCTGCCCCCCTCAATGTCA
TGGGCCGCCAATTTGGGCTCACAGTCGCCTCCCGGAACGCCTCTTGGGCAAACGTTGCGACAGACACGCCCCTCG
GCATGTCCATCGCCACACGCACAAGACCGATGCGTCTCAGTCATCTTTTCGCCTCACGGCATTCCATATAGCAGC
CTCGAGCCCTATGCCACCTCGCACCTCCTCACCGAGGCTGCTCTGCCCCTGACGGCTCTGCTGCACTGTTTTGAA
ACGGTGCATAGCCCGTGGTGTCTTGGCAGCAAGGGCAACTCGGGCATCCACACTGGGCAAGAGATTGCCACTGCG
CTGGGAGCTCGAGCGTGGATCAGCACCTATGATGGAAACAAGATTGCTACAGGCCTAGCCGGCAGGCTCACGGGC
AAGAGCAACAAGTACGATTCGCAGCAAATGCAGCACATGCTACGTCTTGTGTTTGAGCAGGCAGCAAAGGCAGGC
ACAGAGCCTTTGGTTGGCAGGAAGAAACGGGAAGACGTTATTGAGATTCTCGCTCTCAAGTCTGGGGCTCAGGTG
ACGCTGACGAGCGAAGGCATATGGTCCGAGCCGTCAGCCATGGCGAGTGCTCCTGTGGCCAAGCACGACGGCTTG
TAA
Gene >OphauB2|2153
ATGGCGCTTACCATTAAGCAGCTCAATGGCGATGCCTCGTTTCATCTCACCCTGGAGCCCATTCAGGCCAGGTCG
TCATCTGAGCAATATCACATGCTCATTGACCCCTGGATCGCCGGACCCTCGAGCATCCTTCACCCCAAGTTTTCG
TCGACAAGCCATGTCGAGCCGGCCTGCATTTCGTCCCTCAGAGAGCTGCCAGAGCCAGATGTCGTCATAATCAGC
CACAATAGAAGTTCTCACTGCCATGAGGCGACTCTGCGCCAACTGGCGCCCAAAGACACCAAGACACTCATTCTC
GCCGTGCCCGCAGCTGCCCGCTTGATACGGAGCTGGAACTACTTTGACAAGAATAAAGTCAAGACTCTTGACCGC
TGGGAGCATCCGCGCAAAGCTAACCGAGACACGTGCTACCGAATCCCTGTTCCCTCGCAGCTTCTAGGCGGTGGC
GACGGAGAGGTGACAGTCTCGTATATTTCGCATCGCAAGCGCCATCCCAGAGGCCACCATTGTGCCATTGGCATA
ACCTATCGCCCCCCAACCTCGGAATCGTTTGCCTTTTGGCGCCAGACGGCGACGCCTCCCCTGACGCCCAGCTCC
ACCGTGTCGGCCTTGCCACCTCGACTGCCCGCAGCACGGCGCTTCTCCAAGCTAAACCTGCCCCCCTCAATGTCA
TGGGCCGCCAATTTGGGCTCACAGTCGCCTCCCGGAACGCCTCTTGGGCAAACGTTGCGACAGACACGCCCCTCG
GCATGTCCATCGCCACACGCACAAGACCGATGCGTCTCAGTCATCTTTTCGCCTCACGGCATTCCATATAGCAGC
CTCGAGCCCTATGCCACCTCGCACCTCCTCACCGAGGCTGCTCTGCCCCTGACGGCTCTGCTGCACTGTTTTGAA
ACGGTGCATAGCCCGTGGTGTCTTGGCAGCAAGGGCAACTCGGGCATCCACACTGGGCAAGAGATTGCCACTGCG
CTGGGAGCTCGAGCGTGGATCAGCACCTATGATGGAAACAAGATTGCTACAGGCCTAGCCGGCAGGCTCACGGGC
AAGAGCAACAAGTACGATTCGCAGCAAATGCAGCACATGCTACGTCTTGTGTTTGAGCAGGCAGCAAAGGCAGGC
ACAGAGCCTTTGGTTGGCAGGAAGAAACGGGAAGACGTTATTGAGATTCTCGCTCTCAAGTCTGGGGCTCAGGTG
ACGCTGACGAGCGAAGGCATATGGTCCGAGCCGTCAGCCATGGCGAGTGCTCCTGTGGCCAAGCACGACGGCTTG
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail