Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2146
Gene name
LocationContig_165:7011..7830
Strand+
Gene length (bp)819
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 1.6E-17 72 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04675|NODB_BRASP Chitooligosaccharide deacetylase OS=Bradyrhizobium sp. (strain ANU 289) GN=nodB PE=3 SV=2 71 255 5.0E-20
sp|P50352|NODB_BRAEL Chitooligosaccharide deacetylase OS=Bradyrhizobium elkanii GN=nodB PE=3 SV=1 54 255 2.0E-18
sp|P02963|NODB_RHIME Chitooligosaccharide deacetylase OS=Rhizobium meliloti (strain 1021) GN=nodB PE=3 SV=3 63 255 2.0E-16
sp|Q04729|YFUM2_GEOSE Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus PE=3 SV=1 74 262 4.0E-15
sp|P50355|NODB_RHISN Chitooligosaccharide deacetylase OS=Rhizobium sp. (strain NGR234) GN=nodB PE=3 SV=2 77 255 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04675|NODB_BRASP Chitooligosaccharide deacetylase OS=Bradyrhizobium sp. (strain ANU 289) GN=nodB PE=3 SV=2 71 255 5.0E-20
sp|P50352|NODB_BRAEL Chitooligosaccharide deacetylase OS=Bradyrhizobium elkanii GN=nodB PE=3 SV=1 54 255 2.0E-18
sp|P02963|NODB_RHIME Chitooligosaccharide deacetylase OS=Rhizobium meliloti (strain 1021) GN=nodB PE=3 SV=3 63 255 2.0E-16
sp|Q04729|YFUM2_GEOSE Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus PE=3 SV=1 74 262 4.0E-15
sp|P50355|NODB_RHISN Chitooligosaccharide deacetylase OS=Rhizobium sp. (strain NGR234) GN=nodB PE=3 SV=2 77 255 2.0E-14
sp|O34928|PDAA_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaA OS=Bacillus subtilis (strain 168) GN=pdaA PE=1 SV=1 72 266 1.0E-13
sp|Q52845|NODB_RHILO Chitooligosaccharide deacetylase OS=Rhizobium loti (strain MAFF303099) GN=nodB PE=3 SV=2 64 255 2.0E-13
sp|P04339|NODB_RHILV Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. viciae GN=nodB PE=3 SV=1 75 255 6.0E-13
sp|Q8DP63|PGDA_STRR6 Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgdA PE=1 SV=1 74 264 2.0E-12
sp|P50850|YLXY_BACSU Uncharacterized protein YlxY OS=Bacillus subtilis (strain 168) GN=ylxY PE=3 SV=2 96 262 6.0E-12
sp|O34798|PDAC_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaC OS=Bacillus subtilis (strain 168) GN=pdaC PE=1 SV=1 48 261 3.0E-11
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 74 263 1.0E-10
sp|P04676|NODB_RHILT Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. trifolii GN=nodB PE=3 SV=1 58 255 2.0E-10
sp|P50354|NODB_RHIGA Chitooligosaccharide deacetylase OS=Rhizobium galegae GN=nodB PE=3 SV=1 76 255 2.0E-09
sp|Q07740|NODB_AZOC5 Chitooligosaccharide deacetylase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodB PE=3 SV=2 77 253 7.0E-09
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 74 262 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2146
MPRLALFRLPAKLGRRLRRRRMATLSLATTLLLLTLLLPPLACWTIYSPPHALISLLRTHYPDVLFELPAISPRK
LIALSLDDAPSAHTPSIMAALHASNAKATFFVIGAQAPSRFDTLRSLVRAGHELANHAMHDEASRALPDALLAQQ
LADVADVIAAVYRAEKRVLPNNYFRPGSGFFSQRMRALVGKLGFRIVLGSVYPHDAQIPFPALNARHILAKVRPG
AIVICHDRRDWTAPMLRILLPELRRRGYEIVTITDLVRAAEPMPGSS*
Coding >OphauB2|2146
ATGCCCCGACTCGCCCTCTTCCGCCTCCCCGCCAAACTCGGCCGCCGCCTCCGCCGCCGCCGCATGGCCACCCTC
AGCCTCGCCACCACCCTCCTCCTCCTCACCCTCCTCCTCCCCCCCCTCGCCTGCTGGACCATCTACTCCCCCCCC
CACGCCCTCATCTCCCTCCTCCGCACCCACTACCCCGACGTGCTCTTTGAGCTCCCCGCCATCTCCCCCCGCAAA
CTCATTGCCCTCTCTCTCGACGACGCCCCCTCTGCCCACACCCCTTCCATCATGGCCGCCCTGCACGCCTCCAAC
GCAAAAGCAACCTTCTTCGTCATTGGCGCCCAAGCCCCCTCCCGCTTCGACACCCTTCGCTCCCTTGTCCGCGCC
GGCCACGAATTGGCAAACCACGCCATGCATGATGAAGCTTCCCGCGCCCTGCCCGATGCTCTTCTCGCCCAGCAG
CTGGCCGACGTGGCTGACGTGATTGCCGCCGTGTATCGCGCAGAGAAGCGCGTCTTGCCGAATAATTACTTTCGC
CCGGGCTCGGGCTTCTTCTCGCAGCGCATGCGCGCCCTGGTGGGCAAACTGGGCTTTCGCATCGTCTTGGGAAGC
GTTTATCCCCACGACGCGCAGATTCCCTTTCCCGCTCTAAACGCCCGCCACATACTGGCAAAGGTGAGGCCGGGC
GCCATTGTTATATGCCACGACCGCCGCGACTGGACGGCCCCCATGCTGCGCATCCTCCTGCCCGAGCTGCGCCGC
CGCGGATACGAAATCGTTACCATTACCGACTTGGTCAGAGCTGCAGAGCCCATGCCTGGCTCGTCATGA
Transcript >OphauB2|2146
ATGCCCCGACTCGCCCTCTTCCGCCTCCCCGCCAAACTCGGCCGCCGCCTCCGCCGCCGCCGCATGGCCACCCTC
AGCCTCGCCACCACCCTCCTCCTCCTCACCCTCCTCCTCCCCCCCCTCGCCTGCTGGACCATCTACTCCCCCCCC
CACGCCCTCATCTCCCTCCTCCGCACCCACTACCCCGACGTGCTCTTTGAGCTCCCCGCCATCTCCCCCCGCAAA
CTCATTGCCCTCTCTCTCGACGACGCCCCCTCTGCCCACACCCCTTCCATCATGGCCGCCCTGCACGCCTCCAAC
GCAAAAGCAACCTTCTTCGTCATTGGCGCCCAAGCCCCCTCCCGCTTCGACACCCTTCGCTCCCTTGTCCGCGCC
GGCCACGAATTGGCAAACCACGCCATGCATGATGAAGCTTCCCGCGCCCTGCCCGATGCTCTTCTCGCCCAGCAG
CTGGCCGACGTGGCTGACGTGATTGCCGCCGTGTATCGCGCAGAGAAGCGCGTCTTGCCGAATAATTACTTTCGC
CCGGGCTCGGGCTTCTTCTCGCAGCGCATGCGCGCCCTGGTGGGCAAACTGGGCTTTCGCATCGTCTTGGGAAGC
GTTTATCCCCACGACGCGCAGATTCCCTTTCCCGCTCTAAACGCCCGCCACATACTGGCAAAGGTGAGGCCGGGC
GCCATTGTTATATGCCACGACCGCCGCGACTGGACGGCCCCCATGCTGCGCATCCTCCTGCCCGAGCTGCGCCGC
CGCGGATACGAAATCGTTACCATTACCGACTTGGTCAGAGCTGCAGAGCCCATGCCTGGCTCGTCATGA
Gene >OphauB2|2146
ATGCCCCGACTCGCCCTCTTCCGCCTCCCCGCCAAACTCGGCCGCCGCCTCCGCCGCCGCCGCATGGCCACCCTC
AGCCTCGCCACCACCCTCCTCCTCCTCACCCTCCTCCTCCCCCCCCTCGCCTGCTGGACCATCTACTCCCCCCCC
CACGCCCTCATCTCCCTCCTCCGCACCCACTACCCCGACGTGCTCTTTGAGCTCCCCGCCATCTCCCCCCGCAAA
CTCATTGCCCTCTCTCTCGACGACGCCCCCTCTGCCCACACCCCTTCCATCATGGCCGCCCTGCACGCCTCCAAC
GCAAAAGCAACCTTCTTCGTCATTGGCGCCCAAGCCCCCTCCCGCTTCGACACCCTTCGCTCCCTTGTCCGCGCC
GGCCACGAATTGGCAAACCACGCCATGCATGATGAAGCTTCCCGCGCCCTGCCCGATGCTCTTCTCGCCCAGCAG
CTGGCCGACGTGGCTGACGTGATTGCCGCCGTGTATCGCGCAGAGAAGCGCGTCTTGCCGAATAATTACTTTCGC
CCGGGCTCGGGCTTCTTCTCGCAGCGCATGCGCGCCCTGGTGGGCAAACTGGGCTTTCGCATCGTCTTGGGAAGC
GTTTATCCCCACGACGCGCAGATTCCCTTTCCCGCTCTAAACGCCCGCCACATACTGGCAAAGGTGAGGCCGGGC
GCCATTGTTATATGCCACGACCGCCGCGACTGGACGGCCCCCATGCTGCGCATCCTCCTGCCCGAGCTGCGCCGC
CGCGGATACGAAATCGTTACCATTACCGACTTGGTCAGAGCTGCAGAGCCCATGCCTGGCTCGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail