Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2145
Gene name
LocationContig_165:5549..6801
Strand+
Gene length (bp)1252
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 2.2E-63 15 386

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38716|YHR2_YEAST Uncharacterized trans-sulfuration enzyme YHR112C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR112C PE=1 SV=1 13 388 3.0E-104
sp|O42851|YFHE_SCHPO Uncharacterized trans-sulfuration enzyme C23A1.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.14c PE=2 SV=1 8 389 6.0E-91
sp|O05394|MCCB_BACSU Cystathionine gamma-lyase OS=Bacillus subtilis (strain 168) GN=mccB PE=1 SV=1 66 388 1.0E-40
sp|P31373|CYS3_YEAST Cystathionine gamma-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYS3 PE=1 SV=2 10 386 4.0E-40
sp|A2RM21|METC_LACLM Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metC PE=1 SV=1 12 386 7.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38716|YHR2_YEAST Uncharacterized trans-sulfuration enzyme YHR112C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR112C PE=1 SV=1 13 388 3.0E-104
sp|O42851|YFHE_SCHPO Uncharacterized trans-sulfuration enzyme C23A1.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.14c PE=2 SV=1 8 389 6.0E-91
sp|O05394|MCCB_BACSU Cystathionine gamma-lyase OS=Bacillus subtilis (strain 168) GN=mccB PE=1 SV=1 66 388 1.0E-40
sp|P31373|CYS3_YEAST Cystathionine gamma-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYS3 PE=1 SV=2 10 386 4.0E-40
sp|A2RM21|METC_LACLM Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metC PE=1 SV=1 12 386 7.0E-40
sp|P0A4K2|METC_LACLA Cystathionine beta-lyase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metC PE=3 SV=1 12 386 7.0E-40
sp|O31632|METC_BACSU Cystathionine beta-lyase MetC OS=Bacillus subtilis (strain 168) GN=metC PE=1 SV=1 66 389 9.0E-40
sp|P0C2T9|METC_LACLC Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris GN=metC PE=1 SV=1 12 386 9.0E-40
sp|Q55DV9|CGL_DICDI Cystathionine gamma-lyase OS=Dictyostelium discoideum GN=cysA PE=1 SV=1 10 386 2.0E-38
sp|Q1M0P5|METB_HELPX Cystathionine gamma-synthase OS=Helicobacter pylori GN=metB PE=1 SV=1 56 389 5.0E-38
sp|P00935|METB_ECOLI Cystathionine gamma-synthase OS=Escherichia coli (strain K12) GN=metB PE=1 SV=1 27 387 8.0E-38
sp|P56069|METB_HELPY Cystathionine gamma-synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=metB PE=1 SV=1 56 388 2.0E-37
sp|Q9ZMW7|METB_HELPJ Cystathionine gamma-synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=metB PE=3 SV=1 56 389 3.0E-36
sp|P9WGB6|METB_MYCTO Cystathionine gamma-synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metB PE=3 SV=1 7 385 5.0E-35
sp|P66876|METB_MYCBO Cystathionine gamma-synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=metB PE=3 SV=1 7 385 5.0E-35
sp|P9WGB7|METB_MYCTU Cystathionine gamma-synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metB PE=1 SV=1 7 385 5.0E-35
sp|P13254|MEGL_PSEPU Methionine gamma-lyase OS=Pseudomonas putida GN=mdeA PE=1 SV=2 13 387 2.0E-34
sp|O31631|METI_BACSU Cystathionine gamma-synthase/O-acetylhomoserine (thiol)-lyase OS=Bacillus subtilis (strain 168) GN=metI PE=1 SV=1 66 385 2.0E-34
sp|Q83A83|METC_COXBU Cystathionine beta-lyase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metC PE=1 SV=1 66 385 7.0E-34
sp|Q59829|CYSA_STRCO Putative cystathionine gamma-lyase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cysA PE=3 SV=2 57 386 2.0E-32
sp|P53780|METC_ARATH Cystathionine beta-lyase, chloroplastic OS=Arabidopsis thaliana GN=At3g57050 PE=1 SV=1 12 388 2.0E-32
sp|P46807|METB_MYCLE Cystathionine gamma-synthase OS=Mycobacterium leprae (strain TN) GN=metB PE=3 SV=1 7 386 5.0E-32
sp|Q60HG7|CGL_MACFA Cystathionine gamma-lyase OS=Macaca fascicularis GN=CTH PE=2 SV=1 11 387 2.0E-31
sp|P44502|METB_HAEIN Cystathionine gamma-synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metB PE=3 SV=1 66 388 2.0E-30
sp|Q19QT7|CGL_PIG Cystathionine gamma-lyase OS=Sus scrofa GN=CTH PE=2 SV=1 11 393 2.0E-30
sp|P18757|CGL_RAT Cystathionine gamma-lyase OS=Rattus norvegicus GN=Cth PE=1 SV=2 3 387 4.0E-30
sp|O94350|CBL_SCHPO Cystathionine beta-lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=3 SV=4 8 385 2.0E-29
sp|Q8VCN5|CGL_MOUSE Cystathionine gamma-lyase OS=Mus musculus GN=Cth PE=1 SV=1 6 387 1.0E-28
sp|P32929|CGL_HUMAN Cystathionine gamma-lyase OS=Homo sapiens GN=CTH PE=1 SV=3 11 387 2.0E-27
sp|P55217|CGS1_ARATH Cystathionine gamma-synthase 1, chloroplastic OS=Arabidopsis thaliana GN=CGS1 PE=1 SV=3 4 388 2.0E-27
sp|Q9C876|CGS2_ARATH Probable cystathionine gamma-synthase 2 OS=Arabidopsis thaliana GN=CGS2 PE=3 SV=1 37 388 6.0E-27
sp|Q1K8G0|CBL_NEUCR Cystathionine beta-lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-2 PE=1 SV=1 66 385 2.0E-26
sp|P24601|METB_HERAU Probable cystathionine gamma-synthase (Fragment) OS=Herpetosiphon aurantiacus GN=metB PE=3 SV=1 66 336 5.0E-24
sp|Q58DW2|CGL_BOVIN Cystathionine gamma-lyase OS=Bos taurus GN=CTH PE=2 SV=1 11 370 1.0E-23
sp|Q52811|METC_RHIL3 Putative cystathionine beta-lyase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=metC PE=3 SV=2 63 390 2.0E-23
sp|P55216|CGL2_CAEEL Putative cystathionine gamma-lyase 2 OS=Caenorhabditis elegans GN=cth-2 PE=3 SV=1 30 386 2.0E-23
sp|P55218|METZ_PSEAE O-succinylhomoserine sulfhydrylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metZ PE=1 SV=1 64 388 2.0E-23
sp|P53101|STR3_YEAST Cystathionine beta-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STR3 PE=1 SV=1 11 385 2.0E-21
sp|P9WGB5|METZ_MYCTU O-succinylhomoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metZ PE=1 SV=1 62 385 5.0E-21
sp|P9WGB4|METZ_MYCTO O-succinylhomoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metZ PE=3 SV=1 62 385 5.0E-21
sp|Q07703|METC_BORAV Cystathionine beta-lyase OS=Bordetella avium GN=metC PE=1 SV=3 59 386 7.0E-21
sp|P06106|MET17_YEAST Protein MET17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET17 PE=1 SV=3 23 392 7.0E-15
sp|P18949|METC_SALTY Cystathionine beta-lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metC PE=3 SV=2 147 381 1.0E-14
sp|P06721|METC_ECOLI Cystathionine beta-lyase MetC OS=Escherichia coli (strain K12) GN=metC PE=1 SV=1 86 381 1.0E-14
sp|O13326|CYSD_SCHPO O-acetylhomoserine (thiol)-lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.11 PE=2 SV=1 64 386 1.0E-13
sp|P44527|METC_HAEIN Cystathionine beta-lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metC PE=3 SV=1 147 389 2.0E-13
sp|P43623|METC_YEAST Putative cystathionine beta-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC7 PE=1 SV=1 147 323 2.0E-13
sp|Q9SGU9|MGL_ARATH Methionine gamma-lyase OS=Arabidopsis thaliana GN=MGL PE=1 SV=1 22 370 5.0E-13
sp|P50125|CYSD_EMENI O-acetylhomoserine (thiol)-lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cysD PE=2 SV=2 64 385 2.0E-10
sp|Q92441|MET17_KLULA Protein MET17 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MET17 PE=3 SV=3 26 388 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0019346 transsulfuration Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0043436 oxoacid metabolic process No
GO:0019842 vitamin binding No
GO:0006790 sulfur compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0000096 sulfur amino acid metabolic process No
GO:0003674 molecular_function No
GO:1901605 alpha-amino acid metabolic process No
GO:0006534 cysteine metabolic process No
GO:0043167 ion binding No
GO:0006520 cellular amino acid metabolic process No
GO:0050667 homocysteine metabolic process No
GO:0009069 serine family amino acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0070279 vitamin B6 binding No
GO:0044238 primary metabolic process No
GO:0009092 homoserine metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2145
MAPNAQHDASQSLATRAVHADHGIAAHRAVAPAMHVSTTFCYTDDADKLDPQNTTDPLAPQDSHVYSRESAPNTT
RLEAVLSSLLGAPCLTYASGLAAFHAILVHINPRRIAISQGYHGCHAVIDIMSRLTGLEKVALDAEVERGDVIHL
ETPLNPTGEARSIAHYAERAHRLGAHLIVDATLGPPPLQNPFTQGADVVLHSGTKYLGGHSDMLCGVLATKASLA
WHETLRRQRAALGAVMGSLEGWLGLRSVRTLELRVERQSATATALVRWLAEQMQQNASPAAALVLRVQHASLQAD
EAGWLREQMPRGYGPVFALCMRNVEAARRLPGRLSLFQHATSLGGVESLIEWRAMSDAGVDGRLLRVSVGVEAYQ
DLRRDLQQALESLSASRAGE*
Coding >OphauB2|2145
ATGGCGCCCAACGCCCAGCACGACGCCTCGCAATCGCTTGCCACTCGCGCGGTGCACGCCGACCATGGCATCGCG
GCGCACCGAGCCGTGGCGCCGGCAATGCACGTCAGCACCACGTTTTGCTACACCGACGATGCGGACAAGCTCGAT
CCGCAAAACACCACCGACCCGCTGGCGCCTCAAGACTCACACGTCTATTCCCGAGAATCAGCGCCCAACACGACG
CGGCTGGAAGCTGTCTTGTCATCGCTTCTGGGCGCGCCATGCTTGACATATGCATCAGGGCTGGCCGCCTTTCAC
GCCATACTGGTGCACATCAACCCGCGGCGCATAGCCATTAGCCAAGGCTACCACGGGTGCCACGCGGTAATCGAC
ATCATGTCGCGGCTCACGGGCCTGGAAAAAGTAGCGCTCGACGCAGAGGTTGAGCGCGGGGATGTGATTCATCTC
GAGACGCCTCTCAACCCCACTGGCGAGGCCCGCAGCATCGCACACTATGCCGAGCGGGCGCACCGTCTAGGCGCG
CACCTCATTGTCGACGCGACGCTTGGCCCGCCGCCGCTGCAGAATCCATTTACGCAGGGCGCCGACGTGGTGCTG
CACAGCGGAACAAAGTACCTAGGCGGCCACTCCGACATGCTGTGCGGGGTGCTTGCCACCAAGGCATCACTAGCA
TGGCACGAAACACTACGTCGCCAACGCGCTGCGCTGGGTGCCGTAATGGGGAGTCTAGAGGGCTGGCTGGGCCTG
CGCTCCGTGCGGACGCTGGAGCTGCGCGTGGAGCGGCAGAGCGCCACGGCAACGGCGCTGGTGAGGTGGCTGGCG
GAGCAGATGCAGCAAAACGCATCCCCGGCGGCGGCGCTGGTGTTGCGCGTCCAGCATGCTAGTCTCCAGGCTGAC
GAGGCGGGCTGGCTGCGCGAGCAAATGCCGCGGGGCTATGGACCCGTCTTTGCGCTGTGCATGAGGAACGTGGAA
GCGGCGAGGCGGCTGCCGGGGCGACTGAGCCTCTTCCAACATGCCACGAGCCTGGGCGGCGTGGAGAGTCTGATT
GAGTGGCGGGCCATGTCGGATGCGGGCGTGGATGGGCGGCTGCTGCGGGTGAGTGTGGGTGTCGAGGCGTATCAA
GACTTGAGGCGTGATTTGCAGCAGGCGTTGGAGAGTCTGTCGGCGTCGCGTGCTGGCGAGTAA
Transcript >OphauB2|2145
ATGGCGCCCAACGCCCAGCACGACGCCTCGCAATCGCTTGCCACTCGCGCGGTGCACGCCGACCATGGCATCGCG
GCGCACCGAGCCGTGGCGCCGGCAATGCACGTCAGCACCACGTTTTGCTACACCGACGATGCGGACAAGCTCGAT
CCGCAAAACACCACCGACCCGCTGGCGCCTCAAGACTCACACGTCTATTCCCGAGAATCAGCGCCCAACACGACG
CGGCTGGAAGCTGTCTTGTCATCGCTTCTGGGCGCGCCATGCTTGACATATGCATCAGGGCTGGCCGCCTTTCAC
GCCATACTGGTGCACATCAACCCGCGGCGCATAGCCATTAGCCAAGGCTACCACGGGTGCCACGCGGTAATCGAC
ATCATGTCGCGGCTCACGGGCCTGGAAAAAGTAGCGCTCGACGCAGAGGTTGAGCGCGGGGATGTGATTCATCTC
GAGACGCCTCTCAACCCCACTGGCGAGGCCCGCAGCATCGCACACTATGCCGAGCGGGCGCACCGTCTAGGCGCG
CACCTCATTGTCGACGCGACGCTTGGCCCGCCGCCGCTGCAGAATCCATTTACGCAGGGCGCCGACGTGGTGCTG
CACAGCGGAACAAAGTACCTAGGCGGCCACTCCGACATGCTGTGCGGGGTGCTTGCCACCAAGGCATCACTAGCA
TGGCACGAAACACTACGTCGCCAACGCGCTGCGCTGGGTGCCGTAATGGGGAGTCTAGAGGGCTGGCTGGGCCTG
CGCTCCGTGCGGACGCTGGAGCTGCGCGTGGAGCGGCAGAGCGCCACGGCAACGGCGCTGGTGAGGTGGCTGGCG
GAGCAGATGCAGCAAAACGCATCCCCGGCGGCGGCGCTGGTGTTGCGCGTCCAGCATGCTAGTCTCCAGGCTGAC
GAGGCGGGCTGGCTGCGCGAGCAAATGCCGCGGGGCTATGGACCCGTCTTTGCGCTGTGCATGAGGAACGTGGAA
GCGGCGAGGCGGCTGCCGGGGCGACTGAGCCTCTTCCAACATGCCACGAGCCTGGGCGGCGTGGAGAGTCTGATT
GAGTGGCGGGCCATGTCGGATGCGGGCGTGGATGGGCGGCTGCTGCGGGTGAGTGTGGGTGTCGAGGCGTATCAA
GACTTGAGGCGTGATTTGCAGCAGGCGTTGGAGAGTCTGTCGGCGTCGCGTGCTGGCGAGTAA
Gene >OphauB2|2145
ATGGCGCCCAACGCCCAGCACGACGCCTCGCAATCGCTTGCCACTCGCGCGGTGCACGCCGACCATGGCATCGCG
GCGCACCGAGCCGTGGCGCCGGCAATGCACGTCAGCACCACGTTTTGCTACACCGACGATGCGGACAAGCTCGAT
CCGCAAAACACCACCGACGCAAGTCTCTAGCTCACTGACCCTCTTCATCATGCATACTCATTCATCTTGGTCTCT
GCATTAGCCGCTGGCGCCTCAAGACTCACACGTCTATTCCCGAGAATCAGCGCCCAACACGACGCGGCTGGAAGC
TGTCTTGTCATCGCTTCTGGGCGCGCCATGCTTGACATATGCATCAGGGCTGGCCGCCTTTCACGCCATACTGGT
GCACATCAACCCGCGGCGCATAGCCATTAGCCAAGGCTACCACGGGTGCCACGCGGTAATCGACATCATGTCGCG
GCTCACGGGCCTGGAAAAAGTAGCGCTCGACGCAGAGGTTGAGCGCGGGGATGTGATTCATCTCGAGACGCCTCT
CAACCCCACTGGCGAGGCCCGCAGCATCGCACACTATGCCGAGCGGGCGCACCGTCTAGGCGCGCACCTCATTGT
CGACGCGACGCTTGGCCCGCCGCCGCTGCAGAATCCATTTACGCAGGGCGCCGACGTGGTGCTGCACAGCGGAAC
AAAGTACCTAGGCGGCCACTCCGACATGCTGTGCGGGGTGCTTGCCACCAAGGCATCACTAGCATGGCACGAAAC
ACTACGTCGCCAACGCGCTGCGCTGGGTGCCGTAATGGGGAGTCTAGAGGGCTGGCTGGGCCTGCGCTCCGTGCG
GACGCTGGAGCTGCGCGTGGAGCGGCAGAGCGCCACGGCAACGGCGCTGGTGAGGTGGCTGGCGGAGCAGATGCA
GCAAAACGCATCCCCGGCGGCGGCGCTGGTGTTGCGCGTCCAGCATGCTAGTCTCCAGGCTGACGAGGCGGGCTG
GCTGCGCGAGCAAATGCCGCGGGGCTATGGACCCGTCTTTGCGCTGTGCATGAGGAACGTGGAAGCGGCGAGGCG
GCTGCCGGGGCGACTGAGCCTCTTCCAACATGCCACGAGCCTGGGCGGCGTGGAGAGTCTGATTGAGTGGCGGGC
CATGTCGGATGCGGGCGTGGATGGGCGGCTGCTGCGGGTGAGTGTGGGTGTCGAGGCGTATCAAGACTTGAGGCG
TGATTTGCAGCAGGCGTTGGAGAGTCTGTCGGCGTCGCGTGCTGGCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail