Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2141
Gene name
LocationContig_164:42474..43852
Strand+
Gene length (bp)1378
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00134 Cyclin_N Cyclin, N-terminal domain 1.1E-10 119 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74627|CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pch1 PE=1 SV=1 97 298 1.0E-55
sp|Q9FKE6|CCT15_ARATH Cyclin-T1-5 OS=Arabidopsis thaliana GN=CYCT1-5 PE=1 SV=2 70 339 4.0E-27
sp|Q2QQS5|CCT14_ORYSJ Cyclin-T1-4 OS=Oryza sativa subsp. japonica GN=CYCT1-1 PE=2 SV=1 100 347 5.0E-27
sp|O88874|CCNK_MOUSE Cyclin-K OS=Mus musculus GN=Ccnk PE=1 SV=3 100 351 4.0E-26
sp|Q2RAC5|CCT13_ORYSJ Cyclin-T1-3 OS=Oryza sativa subsp. japonica GN=CYCT1-3 PE=3 SV=2 100 339 5.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74627|CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pch1 PE=1 SV=1 97 298 1.0E-55
sp|Q9FKE6|CCT15_ARATH Cyclin-T1-5 OS=Arabidopsis thaliana GN=CYCT1-5 PE=1 SV=2 70 339 4.0E-27
sp|Q2QQS5|CCT14_ORYSJ Cyclin-T1-4 OS=Oryza sativa subsp. japonica GN=CYCT1-1 PE=2 SV=1 100 347 5.0E-27
sp|O88874|CCNK_MOUSE Cyclin-K OS=Mus musculus GN=Ccnk PE=1 SV=3 100 351 4.0E-26
sp|Q2RAC5|CCT13_ORYSJ Cyclin-T1-3 OS=Oryza sativa subsp. japonica GN=CYCT1-3 PE=3 SV=2 100 339 5.0E-26
sp|Q8GYM6|CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana GN=CYCT1-4 PE=1 SV=1 66 339 8.0E-26
sp|O75909|CCNK_HUMAN Cyclin-K OS=Homo sapiens GN=CCNK PE=1 SV=2 100 334 2.0E-25
sp|Q5I0H5|CCNL2_RAT Cyclin-L2 OS=Rattus norvegicus GN=Ccnl2 PE=1 SV=2 97 427 2.0E-23
sp|Q9JJA7|CCNL2_MOUSE Cyclin-L2 OS=Mus musculus GN=Ccnl2 PE=1 SV=1 97 427 2.0E-23
sp|Q7ZVX0|CCNL1_DANRE Cyclin-L1 OS=Danio rerio GN=ccnl1 PE=1 SV=1 101 417 3.0E-23
sp|Q6Z7H3|CCT12_ORYSJ Cyclin-T1-2 OS=Oryza sativa subsp. japonica GN=CYCT1_2 PE=2 SV=2 88 316 4.0E-23
sp|Q5BKF8|CCNL2_XENTR Cyclin-L2 OS=Xenopus tropicalis GN=ccnl2 PE=2 SV=1 110 299 4.0E-23
sp|Q6GN15|CCNL1_XENLA Cyclin-L1 OS=Xenopus laevis GN=ccnl1 PE=2 SV=2 63 299 1.0E-22
sp|Q52KE7|CCNL1_MOUSE Cyclin-L1 OS=Mus musculus GN=Ccnl1 PE=1 SV=1 97 299 4.0E-22
sp|Q9R1Q2|CCNL1_RAT Cyclin-L1 OS=Rattus norvegicus GN=Ccnl1 PE=1 SV=1 97 299 6.0E-22
sp|Q9UK58|CCNL1_HUMAN Cyclin-L1 OS=Homo sapiens GN=CCNL1 PE=1 SV=1 97 299 7.0E-22
sp|Q5ZJP9|CCNL1_CHICK Cyclin-L1 OS=Gallus gallus GN=CCNL1 PE=2 SV=1 97 299 2.0E-21
sp|O60583|CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens GN=CCNT2 PE=1 SV=2 97 319 2.0E-21
sp|Q9XT26|CCNT1_HORSE Cyclin-T1 OS=Equus caballus GN=CCNT1 PE=1 SV=1 88 338 3.0E-21
sp|Q9AS36|CCL11_ORYSJ Cyclin-L1-1 OS=Oryza sativa subsp. japonica GN=CYCL1-1 PE=2 SV=1 98 337 4.0E-21
sp|Q6T8E9|CCNT1_BOVIN Cyclin-T1 OS=Bos taurus GN=CCNT1 PE=1 SV=1 88 320 4.0E-21
sp|Q0E474|CCT11_ORYSJ Cyclin-T1-1 OS=Oryza sativa subsp. japonica GN=CYCT1-1 PE=3 SV=2 100 353 6.0E-21
sp|Q9QWV9|CCNT1_MOUSE Cyclin-T1 OS=Mus musculus GN=Ccnt1 PE=1 SV=3 88 320 1.0E-20
sp|Q8HXN7|CCNT1_PANTR Cyclin-T1 OS=Pan troglodytes GN=CCNT1 PE=2 SV=1 88 320 2.0E-20
sp|O60563|CCNT1_HUMAN Cyclin-T1 OS=Homo sapiens GN=CCNT1 PE=1 SV=1 88 338 3.0E-20
sp|Q96S94|CCNL2_HUMAN Cyclin-L2 OS=Homo sapiens GN=CCNL2 PE=1 SV=1 97 299 3.0E-20
sp|Q8RWV3|CCL11_ARATH Cyclin-L1-1 OS=Arabidopsis thaliana GN=CYCL1-1 PE=1 SV=2 98 337 2.0E-19
sp|Q56YF8|CCT12_ARATH Cyclin-T1-2 OS=Arabidopsis thaliana GN=CYCT1-2 PE=2 SV=2 100 283 3.0E-17
sp|O96433|CCNT_DROME Cyclin-T OS=Drosophila melanogaster GN=CycT PE=1 SV=2 93 338 3.0E-16
sp|Q8LBC0|CCT13_ARATH Cyclin-T1-3 OS=Arabidopsis thaliana GN=CYCT1-3 PE=1 SV=2 76 315 5.0E-16
sp|Q9C8P7|CCT11_ARATH Putative cyclin-T1-1 OS=Arabidopsis thaliana GN=CYCT1-1 PE=3 SV=1 95 316 4.0E-15
sp|Q8N1B3|FA58A_HUMAN Cyclin-related protein FAM58A OS=Homo sapiens GN=FAM58A PE=1 SV=2 119 324 1.0E-14
sp|Q6NRK9|FA58A_XENLA Cyclin-related protein FAM58A OS=Xenopus laevis GN=fam58a PE=2 SV=2 116 321 2.0E-14
sp|Q8QZR8|FA58B_MOUSE Cyclin-related protein FAM58B OS=Mus musculus GN=Fam58b PE=2 SV=2 119 324 1.0E-13
sp|Q4QQW5|FA58A_RAT Cyclin-related protein FAM58A OS=Rattus norvegicus GN=Fam58a PE=2 SV=1 132 324 8.0E-13
sp|Q503D6|FA58A_DANRE Cyclin-related protein FAM58A OS=Danio rerio GN=fam58a PE=2 SV=1 132 271 1.0E-11
sp|Q5RD50|CCNL1_PONAB Cyclin-L1 OS=Pongo abelii GN=CCNL1 PE=3 SV=1 97 197 2.0E-11
sp|Q9FJK6|CCC11_ARATH Cyclin-C1-1 OS=Arabidopsis thaliana GN=CYCC1-1 PE=2 SV=2 116 336 3.0E-09
sp|P25008|CCNC_DROME Cyclin-C OS=Drosophila melanogaster GN=CycC PE=1 SV=1 94 336 5.0E-09
sp|P93411|CCC11_ORYSJ Cyclin-C1-1 OS=Oryza sativa subsp. japonica GN=Os09g0504400 PE=2 SV=1 116 306 5.0E-09
sp|P24863|CCNC_HUMAN Cyclin-C OS=Homo sapiens GN=CCNC PE=1 SV=2 131 338 8.0E-09
sp|Q16JA2|CCNC_AEDAE Cyclin-C OS=Aedes aegypti GN=CycC PE=3 SV=1 131 324 1.0E-08
sp|Q3ZCK5|CCNC_BOVIN Cyclin-C OS=Bos taurus GN=CCNC PE=2 SV=1 131 338 1.0E-08
sp|P39947|CCNC_RAT Cyclin-C OS=Rattus norvegicus GN=Ccnc PE=2 SV=2 131 338 1.0E-08
sp|Q7QB13|CCNC_ANOGA Cyclin-C OS=Anopheles gambiae GN=CycC PE=3 SV=2 131 324 1.0E-08
sp|P55168|CCNC_CHICK Cyclin-C OS=Gallus gallus GN=CCNC PE=3 SV=1 131 338 2.0E-08
sp|Q29AI1|CCNC_DROPS Cyclin-C OS=Drosophila pseudoobscura pseudoobscura GN=CycC PE=3 SV=1 94 336 2.0E-08
sp|P0C7Q3|FA58B_HUMAN Putative cyclin-related protein FAM58B OS=Homo sapiens GN=FAM58BP PE=5 SV=1 132 324 3.0E-08
sp|Q62447|CCNC_MOUSE Cyclin-C OS=Mus musculus GN=Ccnc PE=2 SV=4 131 338 3.0E-08
sp|Q4KLA0|CCNC_XENLA Cyclin-C OS=Xenopus laevis GN=ccnc PE=2 SV=1 131 338 9.0E-08
sp|Q28F72|CCNC_XENTR Cyclin-C OS=Xenopus tropicalis GN=ccnc PE=2 SV=1 131 338 1.0E-07
sp|Q9FJK7|CCC12_ARATH Cyclin-C1-2 OS=Arabidopsis thaliana GN=CYCC1-2 PE=2 SV=1 116 341 1.0E-07
sp|P51947|CCNH_XENLA Cyclin-H OS=Xenopus laevis GN=ccnh PE=1 SV=1 142 296 5.0E-07
sp|Q6CK68|BUR2_KLULA Protein BUR2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BUR2 PE=3 SV=1 54 266 9.0E-07
sp|O59748|CTK2_SCHPO CTD kinase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsc1 PE=1 SV=2 89 299 2.0E-06
sp|Q10D80|CCH11_ORYSJ Cyclin-H1-1 OS=Oryza sativa subsp. japonica GN=CYCH1-1 PE=1 SV=1 104 295 3.0E-06
sp|Q3ZBL9|CCNH_BOVIN Cyclin-H OS=Bos taurus GN=CCNH PE=2 SV=1 142 364 3.0E-06
sp|O94612|YFO5_SCHPO Uncharacterized cyclin-L1-like protein C1296.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1296.05c PE=3 SV=1 129 348 3.0E-06
sp|A4RD79|SSN8_MAGO7 RNA polymerase II holoenzyme cyclin-like subunit OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SSN8 PE=3 SV=1 140 300 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 132 154 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2141
MASIDRYRPPREGYQPPGAPGESRQFESFPPRSPVRRSDVPPAVPTPPSHGSRLSPGAAVQNAAPSAAASGHWSP
SRSQSQSQLQSQMEGQAPTARTNQWSFTPDEILSTPSIIDGLAPSEERLRRAKGVNFIYQAGVMLDLPQITLWVA
AVFFHRFYMRFSMVQEKGGIHHYNIAATALFLANKVEENCRKTKDIIIAVAKVAQKNTKLIIDEQSKEYWRWRDS
ILTYEEIMLEQLTFDLMIDNPYRQLFDLLEALDMIHNKHLRQIAWAFCNDACLTALPLLIESRDVAISSIFFASV
HTNQQVDDVNGEAWWRFLNGDADRCTRAIEVMRQFYTENPLRKQNPSLPSPAFDLENTRRRAETLSSTGGTPKDG
DRASRSPAVRLNGGHEGAGDARDGSGDNATRSPLKRNLVPSSEESRSEKRAKLSEDEGELVEG*
Coding >OphauB2|2141
ATGGCCAGCATCGATCGCTACAGGCCTCCTCGCGAGGGCTACCAGCCGCCGGGGGCGCCGGGCGAGTCACGCCAA
TTCGAGTCTTTTCCGCCTCGCTCGCCGGTGCGCCGCAGCGACGTGCCTCCAGCCGTGCCGACGCCTCCCAGCCAT
GGCTCTCGGCTGTCTCCTGGTGCAGCTGTGCAAAACGCCGCGCCCTCTGCCGCTGCTTCGGGCCACTGGTCGCCT
TCTCGGTCGCAGTCGCAGTCACAGTTGCAGTCGCAGATGGAGGGACAAGCGCCCACGGCTCGCACCAATCAGTGG
TCCTTTACCCCAGACGAGATTCTCAGCACTCCGAGCATCATTGATGGCCTTGCTCCGTCGGAGGAGCGGCTCCGG
AGAGCAAAGGGCGTCAACTTTATTTACCAGGCTGGCGTCATGCTTGACCTGCCTCAAATCACCCTCTGGGTTGCC
GCTGTCTTTTTCCACCGCTTCTACATGCGCTTCAGCATGGTGCAGGAAAAGGGAGGCATCCACCACTATAACATT
GCTGCCACGGCGCTCTTTCTCGCAAACAAGGTGGAGGAAAACTGCAGAAAGACAAAGGACATCATCATTGCTGTT
GCAAAAGTTGCCCAGAAAAACACAAAACTCATTATTGATGAGCAGAGCAAGGAGTACTGGCGATGGAGGGACAGC
ATCCTGACTTATGAGGAAATCATGCTTGAGCAACTCACCTTTGATCTCATGATTGACAACCCCTACCGACAGCTC
TTTGACCTTCTCGAGGCGCTTGACATGATTCACAACAAGCACCTGAGACAGATTGCTTGGGCATTCTGTAACGAT
GCATGCCTCACGGCACTGCCTCTGCTCATTGAGTCGCGAGACGTGGCCATTAGCTCCATTTTCTTTGCCAGCGTG
CACACCAACCAACAAGTCGACGACGTCAATGGTGAAGCCTGGTGGAGGTTTCTCAATGGTGACGCAGACCGCTGC
ACACGCGCCATTGAAGTCATGAGACAGTTTTATACCGAGAACCCGCTGAGAAAACAAAACCCTTCGCTGCCTTCG
CCCGCCTTTGACCTGGAAAACACGAGGCGCCGAGCAGAGACGCTGTCATCGACTGGCGGCACACCCAAAGACGGC
GATCGAGCCAGTCGCAGCCCGGCCGTCCGCCTCAATGGCGGCCACGAGGGAGCAGGCGACGCCAGAGACGGCAGC
GGTGACAATGCGACAAGATCTCCTCTAAAGCGAAACCTTGTGCCCAGCTCTGAAGAGTCGAGATCAGAGAAGCGC
GCAAAGCTGTCCGAGGACGAAGGAGAGCTTGTCGAGGGCTAG
Transcript >OphauB2|2141
ATGGCCAGCATCGATCGCTACAGGCCTCCTCGCGAGGGCTACCAGCCGCCGGGGGCGCCGGGCGAGTCACGCCAA
TTCGAGTCTTTTCCGCCTCGCTCGCCGGTGCGCCGCAGCGACGTGCCTCCAGCCGTGCCGACGCCTCCCAGCCAT
GGCTCTCGGCTGTCTCCTGGTGCAGCTGTGCAAAACGCCGCGCCCTCTGCCGCTGCTTCGGGCCACTGGTCGCCT
TCTCGGTCGCAGTCGCAGTCACAGTTGCAGTCGCAGATGGAGGGACAAGCGCCCACGGCTCGCACCAATCAGTGG
TCCTTTACCCCAGACGAGATTCTCAGCACTCCGAGCATCATTGATGGCCTTGCTCCGTCGGAGGAGCGGCTCCGG
AGAGCAAAGGGCGTCAACTTTATTTACCAGGCTGGCGTCATGCTTGACCTGCCTCAAATCACCCTCTGGGTTGCC
GCTGTCTTTTTCCACCGCTTCTACATGCGCTTCAGCATGGTGCAGGAAAAGGGAGGCATCCACCACTATAACATT
GCTGCCACGGCGCTCTTTCTCGCAAACAAGGTGGAGGAAAACTGCAGAAAGACAAAGGACATCATCATTGCTGTT
GCAAAAGTTGCCCAGAAAAACACAAAACTCATTATTGATGAGCAGAGCAAGGAGTACTGGCGATGGAGGGACAGC
ATCCTGACTTATGAGGAAATCATGCTTGAGCAACTCACCTTTGATCTCATGATTGACAACCCCTACCGACAGCTC
TTTGACCTTCTCGAGGCGCTTGACATGATTCACAACAAGCACCTGAGACAGATTGCTTGGGCATTCTGTAACGAT
GCATGCCTCACGGCACTGCCTCTGCTCATTGAGTCGCGAGACGTGGCCATTAGCTCCATTTTCTTTGCCAGCGTG
CACACCAACCAACAAGTCGACGACGTCAATGGTGAAGCCTGGTGGAGGTTTCTCAATGGTGACGCAGACCGCTGC
ACACGCGCCATTGAAGTCATGAGACAGTTTTATACCGAGAACCCGCTGAGAAAACAAAACCCTTCGCTGCCTTCG
CCCGCCTTTGACCTGGAAAACACGAGGCGCCGAGCAGAGACGCTGTCATCGACTGGCGGCACACCCAAAGACGGC
GATCGAGCCAGTCGCAGCCCGGCCGTCCGCCTCAATGGCGGCCACGAGGGAGCAGGCGACGCCAGAGACGGCAGC
GGTGACAATGCGACAAGATCTCCTCTAAAGCGAAACCTTGTGCCCAGCTCTGAAGAGTCGAGATCAGAGAAGCGC
GCAAAGCTGTCCGAGGACGAAGGAGAGCTTGTCGAGGGCTAG
Gene >OphauB2|2141
ATGGCCAGCATCGATCGCTACAGGCCTCCTCGCGAGGGCTACCAGCCGCCGGGGGCGCCGGGCGAGTCACGCCAA
TTCGAGTCTTTTCCGCCTCGCTCGCCGGTGCGCCGCAGCGACGTGCCTCCAGCCGTGCCGACGCCTCCCAGCCAT
GGCTCTCGGCTGTCTCCTGGTGCAGCTGTGCAAAACGCCGCGCCCTCTGCCGCTGCTTCGGGCCACTGGTCGCCT
TCTCGGTCGCAGTCGCAGTCACAGTTGCAGTCGCAGATGGAGGGACAAGCGCCCACGGCTCGCACCAATCAGTGG
TCCTTTACCCCAGACGAGATTCTCAGCACTCCGAGCATCATTGATGGCCTTGCTCCGTCGGAGGAGCGGCTCCGG
AGAGCAAAGGGCGTCAACTTTATTTACCAGGCTGGCGTCATGCTTGACCTGCCTCAAATCACCCTCTGGGTTGCC
GCTGTCTTTTTCCACCGCTTCTACATGCGCTTCAGCATGGTGCAGGAAAAGGGAGGCATCCACCACTATGTGAGT
CTCCCGTCTTGTGCCGCTTCTTTGTGTATACTGCAGTACTAACGGCTGTTGCTAGAACATTGCTGCCACGGCGCT
CTTTCTCGCAAACAAGGTGGAGGAAAACTGCAGAAAGACAAAGGACATCATCATTGCTGTTGCAAAAGTTGCCCA
GAAAAACACAAAACTCATTATTGATGAGCAGAGCAAGGAGTACTGGCGATGGAGGGACAGCATCCTGACTTATGA
GGAAATCATGCTTGAGCAACTCACCTTTGATCTCATGATTGACAACCCCTACCGACAGCTCTTTGACCTTCTCGA
GGCGCTTGACATGATTCACAACAAGCACCTGAGACAGATTGCTTGGGCATTCTGTAACGATGCATGCCTCACGGC
ACTGCCTCTGCTCATTGAGTCGCGAGACGTGGCCATTAGCTCCATTTTCTTTGCCAGCGTGCACACCAACCAACA
AGTCGACGACGTCAATGGTGAAGCCTGGTGGAGGTTTCTCAATGGTGACGCAGACCGCTGCACACGCGCCATTGA
AGTCATGAGACAGTTTTATACCGAGAACCCGCTGAGAAAACAAAACCCTTCGCTGCCTTCGCCCGCCTTTGACCT
GGAAAACACGAGGCGCCGAGCAGAGACGCTGTCATCGACTGGCGGCACACCCAAAGACGGCGATCGAGCCAGTCG
CAGCCCGGCCGTCCGCCTCAATGGCGGCCACGAGGGAGCAGGCGACGCCAGAGACGGCAGCGGTGACAATGCGAC
AAGATCTCCTCTAAAGCGAAACCTTGTGCCCAGCTCTGAAGAGTCGAGATCAGAGAAGCGCGCAAAGCTGTCCGA
GGACGAAGGAGAGCTTGTCGAGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail