Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2138
Gene name
LocationContig_164:34872..36155
Strand-
Gene length (bp)1283
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase 9.0E-23 28 172

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01738|CDH_PHACH Cellobiose dehydrogenase OS=Phanerochaete chrysosporium GN=CDH-1 PE=1 SV=1 27 186 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 202 224 22
2 234 256 22
3 269 291 22
4 306 328 22
5 335 357 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2138
MKFLANMALATALNAAATFAASAPFCPQADVCFRWAVPETNSSNIYMQLEAPTSFSWVGMGIGSQMRNADMLVMY
AASATNITLSTRRGTGLVMPQHVARADVELLPGSGIANGRMRANVRCRGCRSAKLQRPAHWIAAWAQGKPLDSQD
PAARIHFHDGFDIYTVDLARATVRADENPFVGVQGRGQQAVLKSNEDPTKTLVYAHGVLMTIIFAAGYPLGSILM
PLLGKWLVHASWQIILFLGMWAGFGIGYAITHRVGTVFKSTHTQLGAAVCALMCLQPIFGYLHHLFYLKHRRRGA
FSHVHIWYGRALMLIGIVNGGLGLQLAGNPRGFTIGYCVVAAVCGAAYLAAAVVSALRKPAPQPSPSWSRVEVTK
TNSMS*
Coding >OphauB2|2138
ATGAAGTTTCTCGCCAACATGGCCCTGGCCACGGCCCTGAACGCCGCCGCCACTTTTGCCGCCTCTGCGCCCTTT
TGTCCCCAAGCAGACGTCTGCTTCCGCTGGGCCGTGCCAGAAACCAACTCTTCAAACATTTACATGCAACTCGAA
GCCCCCACCTCCTTTTCCTGGGTCGGCATGGGCATCGGCTCGCAGATGCGCAACGCAGACATGCTCGTCATGTAC
GCCGCCAGCGCCACAAACATCACGCTCAGCACCCGGCGCGGCACGGGACTCGTCATGCCGCAGCACGTGGCGAGG
GCCGACGTGGAGCTTTTGCCCGGCTCGGGTATTGCCAATGGGCGCATGAGGGCAAACGTGCGCTGTCGGGGCTGC
AGGTCGGCCAAGCTGCAGCGGCCGGCGCACTGGATTGCCGCGTGGGCGCAGGGCAAGCCACTCGATTCGCAGGAT
CCGGCGGCGCGCATTCATTTCCATGACGGGTTCGATATATACACGGTGGATTTGGCCAGGGCCACGGTTCGGGCA
GATGAGAATCCCTTTGTTGGCGTGCAGGGGCGCGGGCAGCAAGCCGTGCTCAAGAGCAATGAGGATCCCACAAAG
ACGCTCGTGTACGCGCATGGCGTGCTCATGACAATCATCTTTGCCGCCGGATATCCGCTTGGCTCCATCCTCATG
CCTCTGCTGGGCAAGTGGCTCGTCCATGCCAGCTGGCAAATCATTCTCTTTCTCGGCATGTGGGCGGGCTTTGGC
ATTGGATACGCCATTACCCATCGCGTCGGAACCGTCTTCAAATCAACACACACTCAACTCGGCGCTGCCGTATGC
GCCCTCATGTGTCTCCAGCCCATCTTTGGCTACCTCCACCACCTCTTTTACCTCAAGCACCGCCGCCGCGGCGCC
TTTAGCCACGTCCATATCTGGTACGGCCGCGCCCTCATGCTCATTGGCATCGTCAATGGCGGCCTGGGCCTCCAG
CTCGCCGGTAACCCGCGCGGCTTCACCATTGGCTATTGCGTCGTCGCTGCCGTCTGTGGCGCTGCCTACTTGGCC
GCTGCCGTGGTGAGCGCTCTCAGGAAACCCGCGCCGCAGCCTAGTCCATCTTGGTCGAGGGTCGAAGTGACAAAG
ACGAATTCCATGTCGTAG
Transcript >OphauB2|2138
ATGAAGTTTCTCGCCAACATGGCCCTGGCCACGGCCCTGAACGCCGCCGCCACTTTTGCCGCCTCTGCGCCCTTT
TGTCCCCAAGCAGACGTCTGCTTCCGCTGGGCCGTGCCAGAAACCAACTCTTCAAACATTTACATGCAACTCGAA
GCCCCCACCTCCTTTTCCTGGGTCGGCATGGGCATCGGCTCGCAGATGCGCAACGCAGACATGCTCGTCATGTAC
GCCGCCAGCGCCACAAACATCACGCTCAGCACCCGGCGCGGCACGGGACTCGTCATGCCGCAGCACGTGGCGAGG
GCCGACGTGGAGCTTTTGCCCGGCTCGGGTATTGCCAATGGGCGCATGAGGGCAAACGTGCGCTGTCGGGGCTGC
AGGTCGGCCAAGCTGCAGCGGCCGGCGCACTGGATTGCCGCGTGGGCGCAGGGCAAGCCACTCGATTCGCAGGAT
CCGGCGGCGCGCATTCATTTCCATGACGGGTTCGATATATACACGGTGGATTTGGCCAGGGCCACGGTTCGGGCA
GATGAGAATCCCTTTGTTGGCGTGCAGGGGCGCGGGCAGCAAGCCGTGCTCAAGAGCAATGAGGATCCCACAAAG
ACGCTCGTGTACGCGCATGGCGTGCTCATGACAATCATCTTTGCCGCCGGATATCCGCTTGGCTCCATCCTCATG
CCTCTGCTGGGCAAGTGGCTCGTCCATGCCAGCTGGCAAATCATTCTCTTTCTCGGCATGTGGGCGGGCTTTGGC
ATTGGATACGCCATTACCCATCGCGTCGGAACCGTCTTCAAATCAACACACACTCAACTCGGCGCTGCCGTATGC
GCCCTCATGTGTCTCCAGCCCATCTTTGGCTACCTCCACCACCTCTTTTACCTCAAGCACCGCCGCCGCGGCGCC
TTTAGCCACGTCCATATCTGGTACGGCCGCGCCCTCATGCTCATTGGCATCGTCAATGGCGGCCTGGGCCTCCAG
CTCGCCGGTAACCCGCGCGGCTTCACCATTGGCTATTGCGTCGTCGCTGCCGTCTGTGGCGCTGCCTACTTGGCC
GCTGCCGTGGTGAGCGCTCTCAGGAAACCCGCGCCGCAGCCTAGTCCATCTTGGTCGAGGGTCGAAGTGACAAAG
ACGAATTCCATGTCGTAG
Gene >OphauB2|2138
ATGAAGTTTCTCGCCAACATGGCCCTGGCCACGGCCCTGAGTAAGACTTGTTTACCTGCTTCTGCCTCGTCTCCC
CCAAAAAAAACACTAAACCTCGTCTGCAGACGCCGCCGCCACTTTTGCCGCCTCTGCGCCCTTTTGTCCCCAAGC
AGACGTCTGCTTCCGCTGGGCCGTGCCAGAAACCAACTCTTCAAACATTTACATGCAACTCGAAGCCCCCACCTC
CTTTTCCTGGGTCGGCATGGGCATCGGCTCGCAGATGCGCAACGCAGACATGCTCGTCATGTACGCCGCCAGCGC
CACAAACATCACGCTCAGCACCCGGCGCGGCACGGGACTCGTCATGCCGCAGCACGTGGCGAGGGCCGACGTGGA
GCTTTTGCCCGGCTCGGGTATTGCCAATGGGCGCATGAGGGCAAACGTGCGCTGTCGGGGCTGCAGGTCGGCCAA
GCTGCAGCGGCCGGCGCACTGGATTGCCGCGTGGGCGCAGGGCAAGCCACTCGATTCGCAGGATCCGGCGGCGCG
CATTCATTTCCATGACGGGTTCGATATATACACGGTGGATTTGGCCAGGGCCACGGTTCGGGCAGATGAGAATCC
CTTTGTTGGCGTGCAGGGGCGCGGGCAGCAAGCCGTGCTCAAGAGCAATGAGGATCCCACAAAGACGCTCGTGTA
CGCGCATGGCGTGCTCATGACAATCATCTTTGCCGCCGGATATCCGCTTGGCTCCATCCTCATGCCTCTGCTGGG
CAAGTGGCTCGTCCATGCCAGCTGGCAAATCATTCTCTTTCTCGGCATGTGGGCGGGCTTTGGCATTGGATACGC
CATTACCCATCGCGTCGGAACCGTAAGTCTCGTGCCCCTCAGACACTCGCTCCTCCAGAGAGGCCCAAGGGCAAA
AGCCAAGCTCACTCCTCGCCCAGGTCTTCAAATCAACACACACTCAACTCGGCGCTGCCGTATGCGCCCTCATGT
GTCTCCAGCCCATCTTTGGCTACCTCCACCACCTCTTTTACCTCAAGCACCGCCGCCGCGGCGCCTTTAGCCACG
TCCATATCTGGTACGGCCGCGCCCTCATGCTCATTGGCATCGTCAATGGCGGCCTGGGCCTCCAGCTCGCCGGTA
ACCCGCGCGGCTTCACCATTGGCTATTGCGTCGTCGCTGCCGTCTGTGGCGCTGCCTACTTGGCCGCTGCCGTGG
TGAGCGCTCTCAGGAAACCCGCGCCGCAGCCTAGTCCATCTTGGTCGAGGGTCGAAGTGACAAAGACGAATTCCA
TGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail