Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2126
Gene name
LocationContig_164:9142..10069
Strand-
Gene length (bp)927
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16922 SLD5_C DNA replication complex GINS protein SLD5 C-terminus 4.8E-12 167 221
PF05916 Sld5 GINS complex protein 3.2E-06 47 124

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IQM6|SLD5_GIBZE DNA replication complex GINS protein SLD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SLD5 PE=3 SV=2 1 221 2.0E-119
sp|Q2HE71|SLD5_CHAGB DNA replication complex GINS protein SLD5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SLD5 PE=3 SV=1 1 221 7.0E-104
sp|Q6CE80|SLD5_YARLI DNA replication complex GINS protein SLD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SLD5 PE=3 SV=1 2 221 6.0E-48
sp|Q9P7C8|SLD5_SCHPO DNA replication complex GINS protein sld5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sld5 PE=1 SV=1 2 221 2.0E-37
sp|Q6BXX6|SLD5_DEBHA DNA replication complex GINS protein SLD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SLD5 PE=3 SV=1 1 221 8.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IQM6|SLD5_GIBZE DNA replication complex GINS protein SLD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SLD5 PE=3 SV=2 1 221 2.0E-119
sp|Q2HE71|SLD5_CHAGB DNA replication complex GINS protein SLD5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SLD5 PE=3 SV=1 1 221 7.0E-104
sp|Q6CE80|SLD5_YARLI DNA replication complex GINS protein SLD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SLD5 PE=3 SV=1 2 221 6.0E-48
sp|Q9P7C8|SLD5_SCHPO DNA replication complex GINS protein sld5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sld5 PE=1 SV=1 2 221 2.0E-37
sp|Q6BXX6|SLD5_DEBHA DNA replication complex GINS protein SLD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SLD5 PE=3 SV=1 1 221 8.0E-28
sp|Q753I0|SLD5_ASHGO DNA replication complex GINS protein SLD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SLD5 PE=3 SV=2 1 175 1.0E-25
sp|Q6CKF3|SLD5_KLULA DNA replication complex GINS protein SLD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SLD5 PE=3 SV=1 10 221 2.0E-25
sp|Q03406|SLD5_YEAST DNA replication complex GINS protein SLD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLD5 PE=1 SV=1 9 177 5.0E-21
sp|Q6FT85|SLD5_CANGA DNA replication complex GINS protein SLD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SLD5 PE=3 SV=1 22 221 9.0E-18
sp|Q9BRT9|SLD5_HUMAN DNA replication complex GINS protein SLD5 OS=Homo sapiens GN=GINS4 PE=1 SV=1 9 221 3.0E-17
sp|Q499W2|SLD5_RAT DNA replication complex GINS protein SLD5 OS=Rattus norvegicus GN=Gins4 PE=1 SV=1 24 221 5.0E-15
sp|Q55EA2|SLD5_DICDI DNA replication complex GINS protein SLD5 OS=Dictyostelium discoideum GN=gins4 PE=3 SV=2 24 221 8.0E-15
sp|Q99LZ3|SLD5_MOUSE DNA replication complex GINS protein SLD5 OS=Mus musculus GN=Gins4 PE=1 SV=1 10 221 2.0E-14
sp|A2VE40|SLD5_BOVIN DNA replication complex GINS protein SLD5 OS=Bos taurus GN=GINS4 PE=2 SV=1 27 221 1.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2126
MDIDDILRDIDPAGQNATAATRDLEALTRRWVAERSAPELLDWAPDGLLERVNQRIKAQIEKVEDMTGDMDPRTN
FSLIIIQTELERFKFLVRSYLRARIAKIDAHSLHYLSNDALRARLSPTELAYATRHQALLHNHYLSSFLASFPPP
LQNLNDSAGNMSMIDAPNLDHPVFVRMLRDGLVAAKGTDADNSLPADQGDILILRWSSAKPLVDEGDAELV*
Coding >OphauB2|2126
ATGGACATTGACGACATTTTGCGCGACATTGACCCGGCCGGCCAAAACGCCACAGCTGCGACGCGCGACCTGGAA
GCTCTAACGCGTCGCTGGGTTGCTGAGCGATCTGCCCCGGAGCTTCTCGACTGGGCTCCTGATGGCTTGCTTGAG
CGCGTTAATCAGCGCATCAAGGCGCAGATTGAAAAAGTAGAGGACATGACGGGCGACATGGACCCGCGCACAAAC
TTTTCCCTCATCATCATCCAGACTGAGCTGGAGCGCTTCAAGTTTCTTGTTCGGAGCTATCTGCGCGCTCGCATC
GCAAAGATTGACGCCCACTCCCTCCACTACCTCTCCAACGACGCCCTCCGCGCTCGCCTCTCCCCCACTGAACTC
GCCTACGCCACGCGCCATCAAGCCCTCTTGCATAATCACTACCTCTCCTCCTTTCTCGCCTCCTTTCCACCGCCC
CTGCAAAACTTAAACGACTCGGCTGGCAACATGTCCATGATTGATGCCCCAAACCTCGACCACCCCGTCTTTGTC
CGCATGCTCCGCGACGGCCTCGTTGCAGCAAAGGGTACCGACGCTGATAATTCCTTGCCCGCTGATCAAGGTGAC
ATTTTGATTCTCCGCTGGTCCAGCGCCAAGCCCCTCGTTGACGAGGGAGATGCAGAGCTGGTCTGA
Transcript >OphauB2|2126
ATGGACATTGACGACATTTTGCGCGACATTGACCCGGCCGGCCAAAACGCCACAGCTGCGACGCGCGACCTGGAA
GCTCTAACGCGTCGCTGGGTTGCTGAGCGATCTGCCCCGGAGCTTCTCGACTGGGCTCCTGATGGCTTGCTTGAG
CGCGTTAATCAGCGCATCAAGGCGCAGATTGAAAAAGTAGAGGACATGACGGGCGACATGGACCCGCGCACAAAC
TTTTCCCTCATCATCATCCAGACTGAGCTGGAGCGCTTCAAGTTTCTTGTTCGGAGCTATCTGCGCGCTCGCATC
GCAAAGATTGACGCCCACTCCCTCCACTACCTCTCCAACGACGCCCTCCGCGCTCGCCTCTCCCCCACTGAACTC
GCCTACGCCACGCGCCATCAAGCCCTCTTGCATAATCACTACCTCTCCTCCTTTCTCGCCTCCTTTCCACCGCCC
CTGCAAAACTTAAACGACTCGGCTGGCAACATGTCCATGATTGATGCCCCAAACCTCGACCACCCCGTCTTTGTC
CGCATGCTCCGCGACGGCCTCGTTGCAGCAAAGGGTACCGACGCTGATAATTCCTTGCCCGCTGATCAAGGTGAC
ATTTTGATTCTCCGCTGGTCCAGCGCCAAGCCCCTCGTTGACGAGGGAGATGCAGAGCTGGTCTGA
Gene >OphauB2|2126
ATGGACATTGACGACATTTTGCGCGACATTGACCCGGCCGGCCAAAACGCCACAGCTGCGACGCGCGACCTGGAA
GCTCTAACGCGTCGCTGGGTTGCTGAGCGATCTGCCCCGGAGCTTCTCGAGTGCGTCGCGCTTCCAACTTGGCTC
CGTTTTCCCCTACTTGTGGCTCTCGTCTTGGGTGACTGCTTGCTGATTTTTTTATTTTTTTGCAAACTCGACTTA
GCTGGGCTCCTGATGGCTTGCTTGAGCGCGTTAATCAGCGCATCAAGGCGCAGATTGAAAAAGTAGAGGACATGA
CGGGCGACATGGACCCGCGCACAAACTTTTCCCTCATCATCATCCAGACTGAGCTGGAGCGCTTCAAGTTTCTTG
TTCGGAGCTATCTGCGCGCTCGCATCGCAAAGGTACACTGCTCCTTGCCCTCCAGCTATATTTTCGCTCTTGTAT
TCACCATTCTCGTCACTCTCCCACCATGCATATCTTCTCTCATCTACACCTTGCTCATCACCCACAACCAATTAC
TCTTGTCTACATGTCGCTCACTCACTAAAAAAAAAACTCTAGATTGACGCCCACTCCCTCCACTACCTCTCCAAC
GACGCCCTCCGCGCTCGCCTCTCCCCCACTGAACTCGCCTACGCCACGCGCCATCAAGCCCTCTTGCATAATCAC
TACCTCTCCTCCTTTCTCGCCTCCTTTCCACCGCCCCTGCAAAACTTAAACGACTCGGCTGGCAACATGTCCATG
ATTGATGCCCCAAACCTCGACCACCCCGTCTTTGTCCGCATGCTCCGCGACGGCCTCGTTGCAGCAAAGGGTACC
GACGCTGATAATTCCTTGCCCGCTGATCAAGGTGACATTTTGATTCTCCGCTGGTCCAGCGCCAAGCCCCTCGTT
GACGAGGGAGATGCAGAGCTGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail