Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2111
Gene name
LocationContig_163:23786..25388
Strand+
Gene length (bp)1602
Transcript length (bp)1479
Coding sequence length (bp)1479
Protein length (aa) 493

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04597 Ribophorin_I Ribophorin I 3.0E-145 41 481

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41543|OST1_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST1 PE=1 SV=1 17 476 4.0E-51
sp|Q9GZH4|RPN1_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Caenorhabditis elegans GN=ribo-1 PE=3 SV=2 44 464 1.0E-48
sp|Q10176|OST1_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ost1 PE=3 SV=1 10 454 7.0E-46
sp|Q9ZUA0|OST1B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B OS=Arabidopsis thaliana GN=OST1B PE=2 SV=1 9 491 7.0E-45
sp|Q5RFB6|RPN1_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Pongo abelii GN=RPN1 PE=2 SV=1 118 488 5.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41543|OST1_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST1 PE=1 SV=1 17 476 4.0E-51
sp|Q9GZH4|RPN1_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Caenorhabditis elegans GN=ribo-1 PE=3 SV=2 44 464 1.0E-48
sp|Q10176|OST1_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ost1 PE=3 SV=1 10 454 7.0E-46
sp|Q9ZUA0|OST1B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B OS=Arabidopsis thaliana GN=OST1B PE=2 SV=1 9 491 7.0E-45
sp|Q5RFB6|RPN1_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Pongo abelii GN=RPN1 PE=2 SV=1 118 488 5.0E-44
sp|Q91YQ5|RPN1_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Mus musculus GN=Rpn1 PE=1 SV=1 118 488 8.0E-44
sp|P04843|RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens GN=RPN1 PE=1 SV=1 118 488 1.0E-43
sp|Q4R4T0|RPN1_MACFA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Macaca fascicularis GN=RPN1 PE=2 SV=1 118 488 2.0E-43
sp|Q54C27|OST1_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Dictyostelium discoideum GN=ost1 PE=2 SV=1 148 479 3.0E-42
sp|P07153|RPN1_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Rattus norvegicus GN=Rpn1 PE=2 SV=1 118 488 1.0E-41
sp|B9FDT1|OST1B_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B OS=Oryza sativa subsp. japonica GN=OST1B PE=2 SV=1 50 487 1.0E-41
sp|Q9GMB0|RPN1_PIG Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Sus scrofa GN=RPN1 PE=1 SV=1 118 488 3.0E-41
sp|Q9SFX3|OST1A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A OS=Arabidopsis thaliana GN=OST1A PE=2 SV=1 117 492 1.0E-38
sp|Q0DJC5|OST1A_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A OS=Oryza sativa subsp. japonica GN=OST1A PE=2 SV=1 65 492 1.0E-37
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006486 protein glycosylation Yes
GO:0043412 macromolecule modification No
GO:0070085 glycosylation No
GO:0043413 macromolecule glycosylation No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 466 488 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2111
MKPLSLATALIGLLAPSVLASLTISQSKVTLPAHFKPAQVFSNANLNHIISLEKNYAKEQINVLIENVSQEPQDE
YFIPFTADQVARLGGFQVNDRKDDTAGPFVSEVVEFDAHSPVQYYRIRLPAPLKPGGQQTLAISYYFLKAYTPLP
ASIRQDEEQFLVYPFSVYASSAYATTKQKTEVKMSSSSKVADYTEITAEDTEETFPQKQGSKLVYGPFGAKPAGA
SSPAQVRFEFTKPLTHVSSLERDIEVSHWGGNVAFEERYTLHNRGANLSVPFNRVKWAQAQYFKTNSMALKDMRF
PLQVGSVDAYFTDIIGNVSTSRFRSNQREASLELKPRYPVFGGWKYPFTIGWNSDSANLLRRTSAGSYVLRVPFI
EGPKQPEGIEYEQVHLRVLLPEGAHNVRIWTDIPESSIVDTSVGRRLLYLDTVGRTMVEVKARNIVDELRDRELI
ITYETSLGDMLRKPLVVFASTMAVFMAAWLVGMVEIGIATKS*
Coding >OphauB2|2111
ATGAAGCCTTTGTCACTCGCGACAGCACTCATTGGGCTTCTGGCACCATCAGTTTTGGCCAGTTTGACCATTTCT
CAGTCCAAAGTTACTCTTCCCGCCCACTTCAAGCCAGCTCAAGTCTTCAGCAATGCCAATCTCAACCACATCATC
TCTCTCGAAAAGAACTACGCCAAGGAACAAATAAATGTCTTGATTGAAAATGTGTCTCAAGAGCCTCAAGACGAG
TACTTTATCCCCTTCACCGCCGACCAAGTAGCACGTCTGGGCGGCTTCCAAGTCAATGACCGCAAAGACGACACG
GCAGGACCTTTTGTGTCAGAAGTGGTCGAGTTTGATGCACACAGCCCAGTTCAGTACTATCGCATACGCTTGCCA
GCGCCGCTCAAACCCGGCGGTCAGCAAACACTGGCCATCTCGTATTATTTTCTCAAAGCATACACTCCTCTTCCG
GCGTCGATTCGTCAAGATGAAGAGCAATTCCTTGTTTATCCCTTCTCCGTCTATGCCTCATCAGCCTATGCCACG
ACGAAGCAAAAGACGGAAGTCAAGATGTCGAGCTCATCCAAGGTGGCCGACTACACCGAGATTACTGCCGAGGAC
ACTGAGGAGACTTTTCCCCAGAAGCAAGGATCCAAGCTCGTTTATGGGCCTTTTGGAGCTAAACCTGCCGGCGCT
TCGTCACCAGCGCAAGTTCGCTTCGAGTTTACAAAGCCTTTGACGCACGTTTCCAGTCTCGAGCGTGATATCGAA
GTCAGCCACTGGGGCGGCAATGTTGCGTTTGAGGAGCGGTATACCTTGCACAATCGCGGCGCCAATCTTTCAGTC
CCGTTCAATCGCGTTAAATGGGCTCAAGCACAGTACTTCAAGACAAACTCGATGGCTCTCAAGGACATGCGCTTT
CCTCTTCAGGTGGGAAGTGTCGATGCCTATTTTACAGACATTATTGGCAACGTGTCAACTTCGAGATTTCGAAGC
AACCAACGGGAGGCGTCTCTGGAGCTCAAGCCCCGGTACCCCGTCTTTGGTGGCTGGAAATACCCCTTTACAATC
GGTTGGAACTCGGACAGCGCAAACCTGTTGCGCCGTACTTCCGCTGGATCATATGTGCTCAGGGTACCATTTATT
GAGGGCCCCAAGCAGCCTGAAGGCATCGAATACGAGCAAGTCCACTTGCGCGTCTTGCTTCCTGAAGGAGCTCAC
AATGTTAGAATATGGACAGACATCCCGGAGTCGTCTATTGTTGATACCTCTGTGGGTAGGCGTTTGCTATATCTT
GACACAGTGGGCCGAACCATGGTGGAGGTTAAAGCGCGCAACATTGTAGACGAGCTGAGAGACCGCGAGCTCATC
ATTACGTACGAAACTTCGTTGGGTGATATGCTTCGCAAGCCACTGGTTGTCTTTGCGAGTACAATGGCTGTTTTC
ATGGCAGCATGGCTTGTGGGAATGGTGGAGATTGGAATCGCAACAAAATCATGA
Transcript >OphauB2|2111
ATGAAGCCTTTGTCACTCGCGACAGCACTCATTGGGCTTCTGGCACCATCAGTTTTGGCCAGTTTGACCATTTCT
CAGTCCAAAGTTACTCTTCCCGCCCACTTCAAGCCAGCTCAAGTCTTCAGCAATGCCAATCTCAACCACATCATC
TCTCTCGAAAAGAACTACGCCAAGGAACAAATAAATGTCTTGATTGAAAATGTGTCTCAAGAGCCTCAAGACGAG
TACTTTATCCCCTTCACCGCCGACCAAGTAGCACGTCTGGGCGGCTTCCAAGTCAATGACCGCAAAGACGACACG
GCAGGACCTTTTGTGTCAGAAGTGGTCGAGTTTGATGCACACAGCCCAGTTCAGTACTATCGCATACGCTTGCCA
GCGCCGCTCAAACCCGGCGGTCAGCAAACACTGGCCATCTCGTATTATTTTCTCAAAGCATACACTCCTCTTCCG
GCGTCGATTCGTCAAGATGAAGAGCAATTCCTTGTTTATCCCTTCTCCGTCTATGCCTCATCAGCCTATGCCACG
ACGAAGCAAAAGACGGAAGTCAAGATGTCGAGCTCATCCAAGGTGGCCGACTACACCGAGATTACTGCCGAGGAC
ACTGAGGAGACTTTTCCCCAGAAGCAAGGATCCAAGCTCGTTTATGGGCCTTTTGGAGCTAAACCTGCCGGCGCT
TCGTCACCAGCGCAAGTTCGCTTCGAGTTTACAAAGCCTTTGACGCACGTTTCCAGTCTCGAGCGTGATATCGAA
GTCAGCCACTGGGGCGGCAATGTTGCGTTTGAGGAGCGGTATACCTTGCACAATCGCGGCGCCAATCTTTCAGTC
CCGTTCAATCGCGTTAAATGGGCTCAAGCACAGTACTTCAAGACAAACTCGATGGCTCTCAAGGACATGCGCTTT
CCTCTTCAGGTGGGAAGTGTCGATGCCTATTTTACAGACATTATTGGCAACGTGTCAACTTCGAGATTTCGAAGC
AACCAACGGGAGGCGTCTCTGGAGCTCAAGCCCCGGTACCCCGTCTTTGGTGGCTGGAAATACCCCTTTACAATC
GGTTGGAACTCGGACAGCGCAAACCTGTTGCGCCGTACTTCCGCTGGATCATATGTGCTCAGGGTACCATTTATT
GAGGGCCCCAAGCAGCCTGAAGGCATCGAATACGAGCAAGTCCACTTGCGCGTCTTGCTTCCTGAAGGAGCTCAC
AATGTTAGAATATGGACAGACATCCCGGAGTCGTCTATTGTTGATACCTCTGTGGGTAGGCGTTTGCTATATCTT
GACACAGTGGGCCGAACCATGGTGGAGGTTAAAGCGCGCAACATTGTAGACGAGCTGAGAGACCGCGAGCTCATC
ATTACGTACGAAACTTCGTTGGGTGATATGCTTCGCAAGCCACTGGTTGTCTTTGCGAGTACAATGGCTGTTTTC
ATGGCAGCATGGCTTGTGGGAATGGTGGAGATTGGAATCGCAACAAAATCATGA
Gene >OphauB2|2111
ATGAAGCCTTTGTCACTCGCGACAGCACTCATTGGGCTTCTGGCACCATCAGTTTTGGCCAGTTTGACCATTTCT
CAGTCCAAAGTTACTCTTCCCGCCCACTTCAAGCCAGCTCAAGTCTTCAGCAATGCCAATCTCAACCACATCATC
TCTCTCGAAAAGAACTACGCCAAGGAACAAATAAATGTCTTGATTGAAAATGTGTCTCAAGAGCCTCAAGACGAG
TACTTTATCCCCTTCACCGCCGACCAAGTAGCACGTCTGGGCGGCTTCCAAGTCAATGACCGCAAAGACGACACG
GCAGGACCTTTTGTGTCAGAAGTGGTCGAGTTTGATGCACACAGGTGAGTGTCTTGTGGGCGCACTGCTCTTGAC
TTGACTTGCTGTGCTTGTCGCTGACTCTGGCTCTAGCCCAGTTCAGTACTATCGCATACGCTTGCCAGCGCCGCT
CAAACCCGGCGGTCAGCAAACACTGGCCATCTCGTATTATTTTCTCAAAGCATACACTCCTCTTCCGGCGTCGAT
TCGTCAAGATGAAGAGCAATTCCTTGTTTATCCCTTCTCCGTCTATGCCTCATCAGCCTATGCCACGACGAAGCA
AAAGACGGAAGTCAAGATGTCGAGCTCATCCAAGGTGGCCGACTACACCGAGATTACTGCCGAGGACACTGAGGA
GACTTTTCCCCAGAAGCAAGGATCCAAGCTCGTTTATGGGCCTTTTGGAGCTAAACCTGCCGGCGCTTCGTCACC
AGCGCAAGTTCGCTTCGAGTTTACAAAGCCTTTGACGCACGTTTCCAGTCTCGAGCGTGATATCGAAGTCAGCCA
CTGGGGCGGCAATGTTGCGTTTGAGGAGCGGTATACCTTGCACAATCGCGGCGCCAATCTTTCAGTCCCGTTCAA
TCGCGTTAAATGGGCTCAAGCACAGTACTTCAAGACAAACTCGATGGCTCTCAAGGACATGCGCTTTCCTCTTCA
GGTGGGAAGTGTCGATGCCTATTTTACAGACATTATTGGCAACGTGTCAACTTCGAGATTTCGAAGCAACCAACG
GGAGGCGTCTCTGGAGCTCAAGCCCCGGTACCCCGTCTTTGGTGGCTGGAAATACCCCTTTACAATCGGTTGGAA
CTCGGACAGCGCAAACCTGTTGCGCCGTACTTCCGCTGGATCATATGTGCTCAGGGTACCATTTATTGAGGGCCC
CAAGCAGCCTGAAGGCATCGAATACGAGCAAGTCCACTTGCGCGTCTTGCTTCCTGAAGGAGCTCAGTAAGTGTC
AACTCGCTGCCAGTCTTTTTGTTGTCTAGAGGCTAACATGGAAGCAGCAATGTTAGAATATGGACAGACATCCCG
GAGTCGTCTATTGTTGATACCTCTGTGGGTAGGCGTTTGCTATATCTTGACACAGTGGGCCGAACCATGGTGGAG
GTTAAAGCGCGCAACATTGTAGACGAGCTGAGAGACCGCGAGCTCATCATTACGTACGAAACTTCGTTGGGTGAT
ATGCTTCGCAAGCCACTGGTTGTCTTTGCGAGTACAATGGCTGTTTTCATGGCAGCATGGCTTGTGGGAATGGTG
GAGATTGGAATCGCAACAAAATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail