Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|211
Gene name
LocationContig_10:135203..135888
Strand+
Gene length (bp)685
Transcript length (bp)444
Coding sequence length (bp)444
Protein length (aa) 148

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06179 Med22 Surfeit locus protein 5 subunit 22 of Mediator complex 5.5E-19 15 115

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0016592 mediator complex Yes
GO:0031323 regulation of cellular metabolic process No
GO:0005575 cellular_component No
GO:0010468 regulation of gene expression No
GO:0140110 transcription regulator activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:2001141 regulation of RNA biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0140513 nuclear protein-containing complex No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0032991 protein-containing complex No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|211
MDRSQAAASNLMDMHNRLIADILTRFRTLIMSATIQAQGDRNSANPETISVARISMKLEFDGLFSSIKDLLSLSR
RIKELWTFGPLGQGDPNRQSTESAINHSISQVSQLLNTVEAANMTRLATEAGGEWQRLVHDAPDSSTATSGN*
Coding >OphauB2|211
ATGGACCGCTCACAAGCCGCCGCGTCCAACCTCATGGACATGCACAACCGCCTCATTGCCGATATCCTCACGCGC
TTCCGCACCCTCATCATGTCGGCAACCATTCAAGCCCAAGGTGATCGCAACAGCGCCAATCCAGAAACAATATCC
GTAGCACGCATCTCGATGAAGCTCGAATTTGACGGATTGTTCTCCTCCATCAAAGACCTCCTCTCCCTCTCCCGC
CGCATCAAGGAGCTCTGGACCTTTGGCCCCCTCGGCCAAGGCGACCCCAACCGCCAATCCACCGAGTCGGCCATC
AACCACAGCATCTCTCAAGTCTCCCAGCTCCTCAACACCGTCGAAGCAGCAAACATGACGCGCCTGGCTACCGAA
GCCGGTGGCGAGTGGCAACGCCTTGTTCATGACGCCCCAGACTCGTCCACCGCCACATCAGGCAATTAA
Transcript >OphauB2|211
ATGGACCGCTCACAAGCCGCCGCGTCCAACCTCATGGACATGCACAACCGCCTCATTGCCGATATCCTCACGCGC
TTCCGCACCCTCATCATGTCGGCAACCATTCAAGCCCAAGGTGATCGCAACAGCGCCAATCCAGAAACAATATCC
GTAGCACGCATCTCGATGAAGCTCGAATTTGACGGATTGTTCTCCTCCATCAAAGACCTCCTCTCCCTCTCCCGC
CGCATCAAGGAGCTCTGGACCTTTGGCCCCCTCGGCCAAGGCGACCCCAACCGCCAATCCACCGAGTCGGCCATC
AACCACAGCATCTCTCAAGTCTCCCAGCTCCTCAACACCGTCGAAGCAGCAAACATGACGCGCCTGGCTACCGAA
GCCGGTGGCGAGTGGCAACGCCTTGTTCATGACGCCCCAGACTCGTCCACCGCCACATCAGGCAATTAA
Gene >OphauB2|211
ATGGACCGCTCACAAGCCGCCGCGTCCAACCTCATGGGTTCGCTTTTCTACTCTTGCCTTTCCGCACGCGCTACA
AGCTAAGCACCGCTCATCAGACATGCACAACCGCCTCATTGCCGATATCCTCACGCGCTTCCGCACCCTCATCAT
GTCGGCAACCATTCAAGCCCAAGGTGATCGCAACAGCGCCAATCCAGAAACAATATCCGTAGCACGCATCTCGAT
GAAGCTCGAATTTGACGGATTGGTACGGCTTCCCATCTGCGTCTGCCGCGTCTCCGATTCCTCGTTTTTTTTTTA
AATCTCCAAGACTTTGATGAATCCTTCAAGACCCTCAACTTGCTCAAGACTTTCAAAACTCTTTCCTAGCTAATG
ACTGCCGTTTTACTCCAAGTCGCACCTTTAAACAGCTAACCCGCTCAACCTCTAGTTCTCCTCCATCAAAGACCT
CCTCTCCCTCTCCCGCCGCATCAAGGAGCTCTGGACCTTTGGCCCCCTCGGCCAAGGCGACCCCAACCGCCAATC
CACCGAGTCGGCCATCAACCACAGCATCTCTCAAGTCTCCCAGCTCCTCAACACCGTCGAAGCAGCAAACATGAC
GCGCCTGGCTACCGAAGCCGGTGGCGAGTGGCAACGCCTTGTTCATGACGCCCCAGACTCGTCCACCGCCACATC
AGGCAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail