Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2100
Gene name
LocationContig_162:42119..43765
Strand+
Gene length (bp)1646
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14555 UBA_4 UBA-like domain 7.9E-11 17 57
PF00789 UBX UBX domain 6.2E-08 403 504

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74498|UCP10_SCHPO UBX domain-containing protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp10 PE=3 SV=1 120 503 4.0E-45
sp|Q12229|UBX3_YEAST UBX domain-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX3 PE=1 SV=1 180 503 4.0E-30
sp|Q6GQ69|FAF2B_XENLA FAS-associated factor 2-B OS=Xenopus laevis GN=faf2-b PE=2 SV=1 12 426 1.0E-26
sp|Q28BP9|FAF2_XENTR FAS-associated factor 2 OS=Xenopus tropicalis GN=faf2 PE=2 SV=1 5 426 1.0E-23
sp|Q96CS3|FAF2_HUMAN FAS-associated factor 2 OS=Homo sapiens GN=FAF2 PE=1 SV=2 5 350 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74498|UCP10_SCHPO UBX domain-containing protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp10 PE=3 SV=1 120 503 4.0E-45
sp|Q12229|UBX3_YEAST UBX domain-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX3 PE=1 SV=1 180 503 4.0E-30
sp|Q6GQ69|FAF2B_XENLA FAS-associated factor 2-B OS=Xenopus laevis GN=faf2-b PE=2 SV=1 12 426 1.0E-26
sp|Q28BP9|FAF2_XENTR FAS-associated factor 2 OS=Xenopus tropicalis GN=faf2 PE=2 SV=1 5 426 1.0E-23
sp|Q96CS3|FAF2_HUMAN FAS-associated factor 2 OS=Homo sapiens GN=FAF2 PE=1 SV=2 5 350 2.0E-22
sp|Q3TDN2|FAF2_MOUSE FAS-associated factor 2 OS=Mus musculus GN=Faf2 PE=1 SV=2 5 350 1.0E-21
sp|Q6AZH6|FAF2A_XENLA FAS-associated factor 2-A OS=Xenopus laevis GN=faf2-a PE=2 SV=1 5 481 2.0E-21
sp|Q2HJD0|FAF2_BOVIN FAS-associated factor 2 OS=Bos taurus GN=FAF2 PE=2 SV=1 5 350 4.0E-21
sp|Q9M0N1|PUX10_ARATH Plant UBX domain-containing protein 10 OS=Arabidopsis thaliana GN=PUX10 PE=2 SV=1 173 440 1.0E-20
sp|Q5BK32|FAF2_RAT FAS-associated factor 2 OS=Rattus norvegicus GN=Faf2 PE=2 SV=1 121 350 2.0E-19
sp|Q04228|UBX2_YEAST UBX domain-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX2 PE=1 SV=1 11 453 4.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1939
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5064
Ophiocordyceps australis map64 (Brazil) OphauB2|2100 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03031
Ophiocordyceps camponoti-rufipedis Ophun1|316
Ophiocordyceps kimflemingae Ophio5|6133
Ophiocordyceps subramaniannii Hirsu2|2076

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2100
MADDAAGGAGELSGSQQDALQQYIQVTQQDTADAVALLQRSQWNVQIAIAKFFDGEGPDLVAEATAAQSAPTTSQ
YHDNLQESLMATSDASSHRTRTEAAPRVVPQQSVTRRPPWLLGLLLVPFGWGCRVASSLFRTICYLLSFLPASFR
PRFVTAGPRSPRGRRMLVPQDTAARFKREFDEEYGPNDLPFFQGGLAQAYDLAKKNVKFLLVLLLSPEHDDTPQF
VRETLLAADVVEFISNAANNIIIWGGTVLDSEAYQASVEYNCTKFPFTALVCLTPKDGGGTWMAIVKRLAGPMPP
ATYISELQSAMDRYGGELDVVRAERAAQEMARNIRTEQDSAYERSLAIDRKRATEKKEAAAAAAEAERRRRQENE
ALELLQAKRAQWIAWRANKIIPEPHADDKNVVRVALKMPEAMQAGRIVRRFPPQAPVEELYAFVDCYEQLGQSSK
TAETGESNVKQPEDYQHRYTFRIASTLPRRVHEPSTTATLRETIGKSANLIVEEAPCEEDEDETSSVGTNQYRIE
P*
Coding >OphauB2|2100
ATGGCCGACGACGCCGCTGGTGGTGCTGGCGAGCTGTCTGGGAGCCAGCAAGACGCACTGCAGCAATACATCCAG
GTGACGCAGCAAGACACGGCCGACGCCGTAGCATTGCTACAGCGATCGCAATGGAACGTCCAGATTGCTATTGCA
AAGTTCTTCGATGGCGAAGGGCCAGATCTCGTGGCCGAGGCGACGGCAGCTCAGAGCGCCCCAACCACGTCACAA
TACCACGACAATCTCCAGGAAAGCCTCATGGCCACGTCTGACGCGTCATCGCACCGCACCCGCACCGAAGCTGCG
CCCAGAGTGGTCCCCCAGCAATCCGTTACCCGCCGCCCCCCTTGGCTTCTCGGCCTGCTTCTTGTGCCTTTTGGA
TGGGGCTGTCGTGTAGCCTCGAGTCTTTTCCGCACAATCTGCTACCTCTTGTCATTCTTACCCGCATCCTTCCGC
CCGCGATTTGTGACTGCCGGCCCCAGGAGCCCGCGAGGCCGCCGCATGCTAGTACCCCAAGACACTGCAGCTCGC
TTCAAGCGTGAATTTGACGAGGAGTATGGGCCCAACGACTTGCCCTTCTTTCAAGGTGGCCTAGCCCAGGCATAC
GACTTGGCCAAAAAAAATGTCAAGTTTCTCCTCGTCTTGCTCTTGTCACCCGAACATGACGACACTCCGCAGTTT
GTCCGAGAGACTCTACTTGCCGCTGATGTTGTCGAGTTTATCAGCAACGCTGCCAACAATATCATTATTTGGGGA
GGAACTGTCTTGGACTCAGAGGCATACCAAGCGTCTGTCGAGTACAATTGTACCAAGTTCCCCTTTACTGCTCTG
GTGTGCCTCACACCAAAGGACGGCGGAGGCACGTGGATGGCTATAGTGAAGCGACTAGCGGGCCCAATGCCGCCA
GCGACCTATATATCCGAGCTTCAGAGCGCCATGGATCGCTATGGAGGCGAATTGGATGTTGTACGAGCCGAACGA
GCAGCGCAAGAAATGGCACGCAATATCCGAACCGAGCAAGACTCGGCATATGAAAGATCACTAGCGATTGACAGG
AAGCGTGCCACAGAAAAGAAAGAAGCTGCCGCTGCCGCTGCCGAAGCTGAACGAAGAAGACGTCAAGAGAATGAA
GCATTGGAGCTGCTTCAAGCAAAGCGTGCGCAATGGATAGCATGGCGAGCCAACAAGATAATACCCGAGCCCCAT
GCCGACGACAAGAATGTTGTCCGCGTTGCGCTCAAGATGCCAGAAGCGATGCAAGCAGGCCGCATCGTTCGGCGC
TTTCCACCACAGGCGCCCGTTGAGGAACTCTACGCATTCGTCGACTGCTATGAGCAGCTTGGACAATCAAGCAAG
ACGGCAGAGACAGGCGAAAGCAATGTTAAGCAACCTGAGGACTACCAACATAGATACACGTTTAGAATAGCGTCG
ACATTACCACGGCGGGTCCACGAGCCGAGCACAACAGCAACACTGCGAGAGACGATTGGCAAGTCAGCTAATCTC
ATAGTCGAAGAGGCACCTTGTGAAGAGGATGAAGACGAGACTAGTAGCGTTGGCACAAACCAGTACAGGATAGAA
CCTTGA
Transcript >OphauB2|2100
ATGGCCGACGACGCCGCTGGTGGTGCTGGCGAGCTGTCTGGGAGCCAGCAAGACGCACTGCAGCAATACATCCAG
GTGACGCAGCAAGACACGGCCGACGCCGTAGCATTGCTACAGCGATCGCAATGGAACGTCCAGATTGCTATTGCA
AAGTTCTTCGATGGCGAAGGGCCAGATCTCGTGGCCGAGGCGACGGCAGCTCAGAGCGCCCCAACCACGTCACAA
TACCACGACAATCTCCAGGAAAGCCTCATGGCCACGTCTGACGCGTCATCGCACCGCACCCGCACCGAAGCTGCG
CCCAGAGTGGTCCCCCAGCAATCCGTTACCCGCCGCCCCCCTTGGCTTCTCGGCCTGCTTCTTGTGCCTTTTGGA
TGGGGCTGTCGTGTAGCCTCGAGTCTTTTCCGCACAATCTGCTACCTCTTGTCATTCTTACCCGCATCCTTCCGC
CCGCGATTTGTGACTGCCGGCCCCAGGAGCCCGCGAGGCCGCCGCATGCTAGTACCCCAAGACACTGCAGCTCGC
TTCAAGCGTGAATTTGACGAGGAGTATGGGCCCAACGACTTGCCCTTCTTTCAAGGTGGCCTAGCCCAGGCATAC
GACTTGGCCAAAAAAAATGTCAAGTTTCTCCTCGTCTTGCTCTTGTCACCCGAACATGACGACACTCCGCAGTTT
GTCCGAGAGACTCTACTTGCCGCTGATGTTGTCGAGTTTATCAGCAACGCTGCCAACAATATCATTATTTGGGGA
GGAACTGTCTTGGACTCAGAGGCATACCAAGCGTCTGTCGAGTACAATTGTACCAAGTTCCCCTTTACTGCTCTG
GTGTGCCTCACACCAAAGGACGGCGGAGGCACGTGGATGGCTATAGTGAAGCGACTAGCGGGCCCAATGCCGCCA
GCGACCTATATATCCGAGCTTCAGAGCGCCATGGATCGCTATGGAGGCGAATTGGATGTTGTACGAGCCGAACGA
GCAGCGCAAGAAATGGCACGCAATATCCGAACCGAGCAAGACTCGGCATATGAAAGATCACTAGCGATTGACAGG
AAGCGTGCCACAGAAAAGAAAGAAGCTGCCGCTGCCGCTGCCGAAGCTGAACGAAGAAGACGTCAAGAGAATGAA
GCATTGGAGCTGCTTCAAGCAAAGCGTGCGCAATGGATAGCATGGCGAGCCAACAAGATAATACCCGAGCCCCAT
GCCGACGACAAGAATGTTGTCCGCGTTGCGCTCAAGATGCCAGAAGCGATGCAAGCAGGCCGCATCGTTCGGCGC
TTTCCACCACAGGCGCCCGTTGAGGAACTCTACGCATTCGTCGACTGCTATGAGCAGCTTGGACAATCAAGCAAG
ACGGCAGAGACAGGCGAAAGCAATGTTAAGCAACCTGAGGACTACCAACATAGATACACGTTTAGAATAGCGTCG
ACATTACCACGGCGGGTCCACGAGCCGAGCACAACAGCAACACTGCGAGAGACGATTGGCAAGTCAGCTAATCTC
ATAGTCGAAGAGGCACCTTGTGAAGAGGATGAAGACGAGACTAGTAGCGTTGGCACAAACCAGTACAGGATAGAA
CCTTGA
Gene >OphauB2|2100
ATGGCCGACGACGCCGCTGGTGGTGCTGGCGAGCTGTCTGGGAGCCAGCAAGACGCACTGCAGCAATACATCCAG
GTGACGCAGCAAGACACGGCCGACGCCGTAGCATTGCTACAGCGATCGCAATGGAACGTCCAGGTCAGCGATAAA
TGTCGGTTGCGGCAGTCGTCTGAGTGCCTGACTGACACCAAATTGTCTTGCAGATTGCTATTGCAAAGTTCTTCG
ATGGCGAAGGGCCAGATCTCGTGGCCGAGGCGACGGCAGCTCAGAGCGCCCCAACCACGTCACAATACCACGACA
ATCTCCAGGAAAGCCTCATGGCCACGTCTGACGCGTCATCGCACCGCACCCGCACCGAAGCTGCGCCCAGAGTGG
TCCCCCAGCAATCCGTTACCCGCCGCCCCCCTTGGCTTCTCGGCCTGCTTCTTGTGCCTTTTGGATGGGGCTGTC
GTGTAGCCTCGAGTCTTTTCCGCACAATCTGCTACCTCTTGTCATTCTTACCCGCATCCTTCCGCCCGCGATTTG
TGACTGCCGGCCCCAGGAGCCCGCGAGGCCGCCGCATGCTAGTACCCCAAGACACTGCAGCTCGCTTCAAGCGTG
AATTTGACGAGGAGTATGGGCCCAACGACTTGCCCTTCTTTCAAGGTGGCCTAGCCCAGGCATACGACTTGGCCA
AAAAAAATGTCAAGTTTCTCCTCGTCTTGCTCTTGTCACCCGAACATGACGACACTCCGCAGTTTGTCCGAGAGA
CTCTACTTGCCGCTGATGTTGTCGAGTTTATCAGCAACGCTGCCAACAATATCATTATTTGGGGAGGAACTGTCT
TGGACTCAGAGGCATACCAAGCGTCTGTCGAGTACAATTGTACCAAGTTCCCCTTTACTGCTCTGGTGTGCCTCA
CACCAAAGGACGGCGGAGGCACGTGGATGGCTATAGTGAAGCGACTAGCGGGCCCAATGCCGCCAGCGACCTATA
TATCCGAGCTTCAGAGCGCCATGGATCGCTATGGAGGCGAATTGGATGTTGTACGAGCCGAACGAGCAGCGCAAG
AAATGGCACGCAATATCCGAACCGAGCAAGACTCGGCATATGAAAGATCACTAGCGATTGACAGGAAGCGTGCCA
CAGAAAAGAAAGAAGCTGCCGCTGCCGCTGCCGAAGCTGAACGAAGAAGACGTCAAGAGAATGAAGCATTGGAGC
TGCTTCAAGCAAAGCGTGCGCAATGGATAGCATGGCGAGCCAACAAGATAATACCCGAGCCCCATGCCGACGACA
AGAATGTTGTCCGCGTTGCGCTCAAGATGCCAGAAGCGATGCAAGCAGGCCGCATCGTTCGGCGCTTTCCACCAC
AGGCGCCCGTTGAGGAACTCTACGCATTCGTCGACTGCTATGAGCAGCTTGGACAATCAAGCAAGACGGCAGAGA
CAGGCGAAAGCAATGTTAAGCAACCTGAGGACTACCAACATAGATACACGTTTAGAATAGCGTCGACATTACCAC
GGCGGGTCCACGAGCCGAGCACAACAGCAACACTGCGAGAGACGATTGGCAAGTCAGCTAATCTCATAGTCGAAG
AGGCACCTTGTGAAGAGGATGAAGACGAGACTAGTAGCGTTGGCACAAACCAGTACAGGATAGAACCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail