Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2087
Gene name
LocationContig_162:14153..15260
Strand-
Gene length (bp)1107
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 10 32 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4941
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5077
Ophiocordyceps australis map64 (Brazil) OphauB2|2087 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00531
Ophiocordyceps camponoti-rufipedis Ophun1|3393
Ophiocordyceps subramaniannii Hirsu2|1842

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2087
MAWHLSGRSFGLGIVVGFLVALALAVVLAAIVLRTRDVYSLGHWKLNVRTPLRSMWMNLGYWKTPDGRPVEYFDE
ACQGLLRVILEAAGLLTVPGDTEAAPKGTAVLDLGFGCGDQTLALARLVPREARRKFGYVGLTLNETQVRTATGM
LDRELVSCTGAIAHLPDRASFTLFCADAARPETWSPAIRQSVQQLADQSFTQKWLLALDCLYHFSPSRRPILQFA
ARKLDAGVMAFDLILNEQASTTQRLVVRMVGVMMNCPWHTFLTEDEYRAQLVECGYDSNTITIQDISDNVFAGVS
GYILRQEAALGRYGISIGGFKLAARLFAWFDRSRVVKAVIVVGRSKGKTE*
Coding >OphauB2|2087
ATGGCATGGCATCTTTCGGGCCGCAGCTTCGGCCTCGGCATCGTCGTAGGCTTCTTAGTTGCTTTGGCATTGGCT
GTTGTCCTGGCCGCCATTGTGCTCCGAACTCGCGATGTCTACAGCCTGGGCCATTGGAAGCTGAATGTGCGAACA
CCCCTGAGGTCCATGTGGATGAACTTGGGTTACTGGAAAACGCCAGACGGCAGGCCAGTCGAGTATTTTGATGAA
GCGTGTCAAGGCCTCCTCAGAGTCATTTTGGAGGCTGCTGGCTTGCTCACAGTGCCGGGTGATACAGAAGCTGCT
CCCAAGGGGACGGCAGTGCTTGATCTTGGCTTTGGCTGTGGCGACCAGACGCTAGCCTTGGCGCGACTCGTACCT
CGAGAGGCAAGACGGAAATTCGGCTACGTGGGCCTGACCCTGAATGAGACTCAAGTTCGGACAGCTACAGGGATG
CTCGATCGCGAACTTGTGTCATGCACGGGCGCAATCGCTCATTTGCCCGACCGGGCCTCCTTTACTCTCTTCTGC
GCCGATGCAGCGCGTCCAGAGACTTGGAGTCCAGCCATTCGCCAATCGGTCCAGCAGCTGGCCGATCAATCCTTT
ACGCAAAAGTGGCTGCTAGCCTTGGACTGCCTCTATCACTTCTCCCCTTCGCGCAGGCCAATCCTGCAGTTTGCG
GCCCGTAAACTTGATGCAGGCGTCATGGCGTTTGACCTGATACTCAACGAGCAAGCTTCAACGACGCAGCGACTC
GTGGTGCGAATGGTTGGCGTCATGATGAATTGTCCCTGGCACACTTTTCTCACCGAGGACGAGTACCGGGCGCAG
CTGGTAGAATGTGGCTACGACAGTAACACTATTACCATTCAGGACATCTCAGACAATGTTTTTGCCGGTGTGAGT
GGATACATTCTGCGGCAGGAAGCGGCACTTGGGCGGTACGGCATTTCCATTGGCGGCTTCAAGCTGGCGGCGCGG
CTGTTTGCCTGGTTCGACCGGTCGCGAGTAGTCAAGGCCGTCATTGTTGTTGGCCGCAGCAAAGGCAAGACGGAG
TAG
Transcript >OphauB2|2087
ATGGCATGGCATCTTTCGGGCCGCAGCTTCGGCCTCGGCATCGTCGTAGGCTTCTTAGTTGCTTTGGCATTGGCT
GTTGTCCTGGCCGCCATTGTGCTCCGAACTCGCGATGTCTACAGCCTGGGCCATTGGAAGCTGAATGTGCGAACA
CCCCTGAGGTCCATGTGGATGAACTTGGGTTACTGGAAAACGCCAGACGGCAGGCCAGTCGAGTATTTTGATGAA
GCGTGTCAAGGCCTCCTCAGAGTCATTTTGGAGGCTGCTGGCTTGCTCACAGTGCCGGGTGATACAGAAGCTGCT
CCCAAGGGGACGGCAGTGCTTGATCTTGGCTTTGGCTGTGGCGACCAGACGCTAGCCTTGGCGCGACTCGTACCT
CGAGAGGCAAGACGGAAATTCGGCTACGTGGGCCTGACCCTGAATGAGACTCAAGTTCGGACAGCTACAGGGATG
CTCGATCGCGAACTTGTGTCATGCACGGGCGCAATCGCTCATTTGCCCGACCGGGCCTCCTTTACTCTCTTCTGC
GCCGATGCAGCGCGTCCAGAGACTTGGAGTCCAGCCATTCGCCAATCGGTCCAGCAGCTGGCCGATCAATCCTTT
ACGCAAAAGTGGCTGCTAGCCTTGGACTGCCTCTATCACTTCTCCCCTTCGCGCAGGCCAATCCTGCAGTTTGCG
GCCCGTAAACTTGATGCAGGCGTCATGGCGTTTGACCTGATACTCAACGAGCAAGCTTCAACGACGCAGCGACTC
GTGGTGCGAATGGTTGGCGTCATGATGAATTGTCCCTGGCACACTTTTCTCACCGAGGACGAGTACCGGGCGCAG
CTGGTAGAATGTGGCTACGACAGTAACACTATTACCATTCAGGACATCTCAGACAATGTTTTTGCCGGTGTGAGT
GGATACATTCTGCGGCAGGAAGCGGCACTTGGGCGGTACGGCATTTCCATTGGCGGCTTCAAGCTGGCGGCGCGG
CTGTTTGCCTGGTTCGACCGGTCGCGAGTAGTCAAGGCCGTCATTGTTGTTGGCCGCAGCAAAGGCAAGACGGAG
TAG
Gene >OphauB2|2087
ATGGCATGGCATCTTTCGGGCCGCAGCTTCGGCCTCGGCATCGTCGTAGGCTTCTTAGTTGCTTTGGCATTGGCT
GTTGTCCTGGCCGCCATTGTGCTCCGAACTCGCGATGTCTACAGCCTGGGCCATTGGAAGCTGAATGTGCGAACA
CCCCTGAGGTCCATGTGGATGAACTTGGGTTACTGGTAGGCTAGCCCTTGACTCGGTCTTGTGGCGCATAGAGTT
CATGCCTTGTCTAGGAAAACGCCAGACGGCAGGCCAGTCGAGTATTTTGATGAAGCGTGTCAAGGCCTCCTCAGA
GTCATTTTGGAGGCTGCTGGCTTGCTCACAGTGCCGGGTGATACAGAAGCTGCTCCCAAGGGGACGGCAGTGCTT
GATCTTGGCTTTGGCTGTGGCGACCAGACGCTAGCCTTGGCGCGACTCGTACCTCGAGAGGCAAGACGGAAATTC
GGCTACGTGGGCCTGACCCTGAATGAGACTCAAGTTCGGACAGCTACAGGGATGCTCGATCGCGAACTTGTGTCA
TGCACGGGCGCAATCGCTCATTTGCCCGACCGGGCCTCCTTTACTCTCTTCTGCGCCGATGCAGCGCGTCCAGAG
ACTTGGAGTCCAGCCATTCGCCAATCGGTCCAGCAGCTGGCCGATCAATCCTTTACGCAAAAGTGGCTGCTAGCC
TTGGACTGCCTCTATCACTTCTCCCCTTCGCGCAGGCCAATCCTGCAGTTTGCGGCCCGTAAACTTGATGCAGGC
GTCATGGCGTTTGACCTGATACTCAACGAGCAAGCTTCAACGACGCAGCGACTCGTGGTGCGAATGGTTGGCGTC
ATGATGAATTGTCCCTGGCACACTTTTCTCACCGAGGACGAGTACCGGGCGCAGCTGGTAGAATGTGGCTACGAC
AGTAACACTATTACCATTCAGGACATCTCAGACAATGTTTTTGCCGGTGTGAGTGGATACATTCTGCGGCAGGAA
GCGGCACTTGGGCGGTACGGCATTTCCATTGGCGGCTTCAAGCTGGCGGCGCGGCTGTTTGCCTGGTTCGACCGG
TCGCGAGTAGTCAAGGCCGTCATTGTTGTTGGCCGCAGCAAAGGCAAGACGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail