Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|207
Gene name
LocationContig_10:123433..124847
Strand+
Gene length (bp)1414
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.2E-64 111 421
PF14543 TAXi_N Xylanase inhibitor N-terminal 1.2E-07 112 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11838|CARP_CRYPA Endothiapepsin OS=Cryphonectria parasitica GN=EAPA PE=1 SV=2 23 422 7.0E-96
sp|O13340|CARP_PODAS Podosporapepsin OS=Podospora anserina GN=PAPA PE=2 SV=1 3 422 7.0E-95
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 2 420 2.0E-85
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 2 420 2.0E-85
sp|Q69IF8|PEPA_PHANO Aspartic protease PEP1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PEP1 PE=3 SV=1 36 427 2.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11838|CARP_CRYPA Endothiapepsin OS=Cryphonectria parasitica GN=EAPA PE=1 SV=2 23 422 7.0E-96
sp|O13340|CARP_PODAS Podosporapepsin OS=Podospora anserina GN=PAPA PE=2 SV=1 3 422 7.0E-95
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 2 420 2.0E-85
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 2 420 2.0E-85
sp|Q69IF8|PEPA_PHANO Aspartic protease PEP1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PEP1 PE=3 SV=1 36 427 2.0E-83
sp|B8MF81|PEPA_TALSN Aspartic protease pep1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=pep1 PE=3 SV=1 109 420 4.0E-83
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 35 420 4.0E-83
sp|E5A7T3|PEPA_LEPMJ Aspartic protease PEP1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=PEP1 PE=3 SV=2 36 411 1.0E-82
sp|A1DDK1|PEPA_NEOFI Aspartic protease pep1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pep1 PE=3 SV=1 2 420 1.0E-81
sp|P41748|PEPA_ASPFU Aspartic protease pep1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep1 PE=1 SV=2 2 420 2.0E-81
sp|B0Y1V8|PEPA_ASPFC Aspartic protease pep1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pep1 PE=3 SV=1 2 420 2.0E-81
sp|P00798|PENP_PENJA Penicillopepsin OS=Penicillium janthinellum PE=1 SV=2 97 420 2.0E-79
sp|B6HL60|PEPA_PENRW Aspartic protease pep1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=pep1 PE=3 SV=1 35 420 4.0E-79
sp|A2R3L3|PEPA_ASPNC Aspartic protease pep1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pep1 PE=3 SV=1 2 420 2.0E-78
sp|Q12567|PEPA_ASPPH Aspartic protease pep1 OS=Aspergillus phoenicis GN=pep1 PE=1 SV=1 2 420 6.0E-78
sp|P78735|PEPA_PENJA Aspartic protease pepA OS=Penicillium janthinellum GN=pepA PE=1 SV=1 56 420 7.0E-78
sp|P17946|PEPA_ASPAW Aspartic protease pep1 OS=Aspergillus awamori GN=pep1 PE=1 SV=1 2 420 1.0E-77
sp|P55325|PEPA_ASPNG Aspartic protease pep1 OS=Aspergillus niger GN=pep1 PE=1 SV=1 2 420 6.0E-77
sp|O93885|PEPA_EMENI Aspartic protease pep1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pep1 PE=3 SV=1 3 420 2.0E-74
sp|A1CBR4|PEPA_ASPCL Aspartic protease pep1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pep1 PE=3 SV=1 2 420 3.0E-74
sp|D4ANC3|PEPA_ARTBC Aspartic protease PEP1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP1 PE=3 SV=1 33 420 2.0E-72
sp|D4D7C5|PEPA_TRIVH Aspartic endopeptidase PEP1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP1 PE=3 SV=1 33 420 6.0E-72
sp|E5R1B9|PEPA_ARTGP Aspartic protease PEP1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=PEP1 PE=3 SV=1 3 420 9.0E-72
sp|Q01972|PEPA_PENRO Aspartic protease pep1 OS=Penicillium roqueforti GN=pep1 PE=2 SV=1 24 420 2.0E-70
sp|D4DE18|Y5382_TRIVH Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 68 423 3.0E-66
sp|C5FBS2|PEPA_ARTOC Aspartic protease PEP1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP1 PE=3 SV=1 33 420 3.0E-63
sp|Q4WZS3|Y5950_ASPFU Putative aspergillopepsin A-like aspartic endopeptidase AFUA_2G15950 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G15950 PE=3 SV=2 23 423 3.0E-61
sp|C5FZ57|Y7979_ARTOC Putative aspergillopepsin A-like aspartic endopeptidase MCYG_07979 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07979 PE=3 SV=1 58 420 5.0E-58
sp|D4AT39|Y7403_ARTBC Probable aspartic-type endopeptidase ARB_07403 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07403 PE=3 SV=2 108 411 8.0E-58
sp|D4DGR1|Y6366_TRIVH Probable aspartic-type endopeptidase TRV_06366 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06366 PE=3 SV=1 108 411 2.0E-57
sp|C5PEI9|PEPA_COCP7 Aspartic protease PEP3 OS=Coccidioides posadasii (strain C735) GN=PEP3 PE=3 SV=1 109 411 5.0E-57
sp|D4AIC4|Y4018_ARTBC Probable aspartic-type endopeptidase ARB_04018 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04018 PE=3 SV=1 68 423 8.0E-54
sp|C5FW52|Y6955_ARTOC Probable aspartic-type endopeptidase MCYG_06955 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_06955 PE=3 SV=1 98 423 2.0E-49
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 109 420 1.0E-30
sp|P81214|CARP_SYNRA Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 108 423 2.0E-29
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 109 411 8.0E-28
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 102 411 3.0E-27
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 109 420 3.0E-27
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 109 411 6.0E-25
sp|P10602|CARP1_RHINI Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 78 411 8.0E-25
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 109 411 1.0E-24
sp|Q800A0|CATE_LITCT Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 82 420 2.0E-22
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 109 423 3.0E-22
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 71 420 9.0E-22
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 72 420 9.0E-22
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 109 420 9.0E-22
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 65 420 2.0E-21
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 109 420 5.0E-21
sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 96 420 7.0E-21
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 67 420 8.0E-21
sp|P14091|CATE_HUMAN Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 109 420 2.0E-20
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 104 420 3.0E-20
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 104 420 4.0E-20
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 109 420 4.0E-20
sp|P83495|PAG4_SHEEP Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 107 420 5.0E-20
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 104 420 6.0E-20
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 109 420 8.0E-20
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 70 420 1.0E-19
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 104 420 1.0E-19
sp|Q4LAL9|CATD_CANLF Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 90 420 3.0E-19
sp|Q4WNV0|CTSD_ASPFU Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 83 422 4.0E-19
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 109 420 4.0E-19
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 72 424 6.0E-19
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 109 420 6.0E-19
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 109 423 8.0E-19
sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 90 421 1.0E-18
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 108 423 1.0E-18
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 71 420 1.0E-18
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 109 420 2.0E-18
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 109 420 3.0E-18
sp|Q05744|CATD_CHICK Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1 109 421 3.0E-18
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 104 421 3.0E-18
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 71 420 4.0E-18
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 109 420 4.0E-18
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 109 420 4.0E-18
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 109 423 5.0E-18
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 65 420 6.0E-18
sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 109 421 6.0E-18
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 108 423 6.0E-18
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 109 420 7.0E-18
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 104 421 8.0E-18
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 109 423 1.0E-17
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 95 420 1.0E-17
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 109 423 1.0E-17
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 109 420 1.0E-17
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 110 423 1.0E-17
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 50 420 1.0E-17
sp|P80209|CATD_BOVIN Cathepsin D OS=Bos taurus GN=CTSD PE=1 SV=2 109 421 1.0E-17
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 71 420 2.0E-17
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 109 420 2.0E-17
sp|P27823|PEPAF_RABIT Pepsin F OS=Oryctolagus cuniculus PE=2 SV=1 109 420 2.0E-17
sp|P43159|CATE_RABIT Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 109 420 2.0E-17
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 79 423 2.0E-17
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 109 420 3.0E-17
sp|Q9DEX3|CATD_CLUHA Cathepsin D OS=Clupea harengus GN=ctsd PE=1 SV=1 109 420 3.0E-17
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 104 421 5.0E-17
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 109 420 5.0E-17
sp|P24268|CATD_RAT Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1 109 424 5.0E-17
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 109 420 5.0E-17
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 50 420 6.0E-17
sp|P55956|ASP3_CAEEL Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 109 424 6.0E-17
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 109 420 7.0E-17
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 109 420 8.0E-17
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 67 420 8.0E-17
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 109 420 1.0E-16
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 129 423 2.0E-16
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 95 423 2.0E-16
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 109 421 2.0E-16
sp|P09177|CARP_RHIPU Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 106 420 2.0E-16
sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 109 419 2.0E-16
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 109 420 2.0E-16
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 109 420 5.0E-16
sp|P00794|CHYM_BOVIN Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 98 420 7.0E-16
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 109 420 1.0E-15
sp|P00795|CATD_PIG Cathepsin D OS=Sus scrofa GN=CTSD PE=1 SV=2 109 420 1.0E-15
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 53 420 1.0E-15
sp|P18276|CHYM_SHEEP Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 98 420 2.0E-15
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 109 420 3.0E-15
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 111 420 5.0E-15
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 109 420 7.0E-15
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 72 427 2.0E-14
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 109 420 2.0E-14
sp|Q9MZS8|CATD_SHEEP Cathepsin D (Fragment) OS=Ovis aries GN=CTSD PE=1 SV=1 96 353 5.0E-14
sp|P39898|PLM1_PLAFA Plasmepsin-1 OS=Plasmodium falciparum PE=1 SV=2 117 420 2.0E-13
sp|Q7KQM4|PLM1_PLAF7 Plasmepsin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0076 PE=2 SV=1 117 420 2.0E-13
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 109 428 5.0E-13
sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 107 421 5.0E-13
sp|P46925|PLM2_PLAFA Plasmepsin-2 OS=Plasmodium falciparum PE=1 SV=1 117 420 7.0E-13
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 109 428 9.0E-12
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 112 427 1.0E-11
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 96 357 3.0E-11
sp|Q5A651|CAR10_CANAL Candidapepsin-10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP10 PE=1 SV=1 95 420 3.0E-11
sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 94 343 3.0E-11
sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 100 351 3.0E-11
sp|Q92389|AXP1_YARLI Acid extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AXP1 PE=3 SV=1 77 420 5.0E-11
sp|P00796|RENI2_MOUSE Renin-2 OS=Mus musculus GN=Ren2 PE=1 SV=1 109 420 8.0E-11
sp|P08424|RENI_RAT Renin OS=Rattus norvegicus GN=Ren1 PE=2 SV=2 109 420 1.0E-10
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 112 428 1.0E-10
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 112 428 1.0E-10
sp|Q6DYE7|RENI_CANLF Renin OS=Canis lupus familiaris GN=REN PE=2 SV=1 109 420 1.0E-10
sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 109 343 1.0E-10
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 101 423 1.0E-10
sp|Q9TSZ1|RENI_CALJA Renin OS=Callithrix jacchus GN=REN PE=2 SV=1 66 420 2.0E-10
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 101 423 3.0E-10
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 101 427 3.0E-10
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 101 423 3.0E-10
sp|P40782|CYPR1_CYNCA Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 109 343 4.0E-10
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 109 329 5.0E-10
sp|P52115|RENI_SHEEP Renin OS=Ovis aries GN=REN PE=2 SV=1 109 420 7.0E-10
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 101 427 8.0E-10
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 112 420 9.0E-10
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 101 427 9.0E-10
sp|Q9XFX3|CARDA_CYNCA Procardosin-A OS=Cynara cardunculus GN=cardA PE=1 SV=1 91 329 1.0E-09
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 109 352 2.0E-09
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 112 428 2.0E-09
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 112 427 3.0E-09
sp|P06281|RENI1_MOUSE Renin-1 OS=Mus musculus GN=Ren1 PE=1 SV=1 109 420 4.0E-09
sp|P17576|CARP_IRPLA Polyporopepsin OS=Irpex lacteus PE=1 SV=1 100 419 4.0E-09
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 105 423 7.0E-09
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 112 423 7.0E-09
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 94 423 1.0E-08
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 101 423 1.0E-08
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 101 423 1.0E-08
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 101 423 1.0E-08
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 111 427 2.0E-08
sp|P85137|CARDF_CYNCA Cardosin-F (Fragments) OS=Cynara cardunculus PE=1 SV=1 109 420 2.0E-08
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 111 427 2.0E-08
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 123 427 2.0E-08
sp|P42210|ASPR_HORVU Phytepsin OS=Hordeum vulgare PE=1 SV=1 72 352 5.0E-08
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 94 423 8.0E-08
sp|W8W138|BACE_STRPU Beta-secretase OS=Strongylocentrotus purpuratus GN=BACE PE=2 SV=1 112 420 3.0E-07
sp|Q6DLS0|RENI_MACFA Renin OS=Macaca fascicularis GN=REN PE=2 SV=1 99 420 5.0E-07
sp|P60016|RENI_PANTR Renin OS=Pan troglodytes GN=REN PE=3 SV=1 99 420 5.0E-07
sp|P00797|RENI_HUMAN Renin OS=Homo sapiens GN=REN PE=1 SV=1 99 420 5.0E-07
sp|Q6DLW5|RENI_MACMU Renin OS=Macaca mulatta GN=REN PE=2 SV=2 66 420 5.0E-07
sp|O04057|ASPR_CUCPE Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 109 327 9.0E-07
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 112 341 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999759

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup359
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2835
Ophiocordyceps australis 1348a (Ghana) OphauG2|4214
Ophiocordyceps australis map64 (Brazil) OphauB2|207 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6809
Ophiocordyceps camponoti-floridani Ophcf2|07009
Ophiocordyceps camponoti-rufipedis Ophun1|669
Ophiocordyceps kimflemingae Ophio5|6684
Ophiocordyceps subramaniannii Hirsu2|6995
Ophiocordyceps subramaniannii Hirsu2|7389
Ophiocordyceps subramaniannii Hirsu2|7390

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|207
MKVALLSLALASLAESVALSTGPSSPSQNQQPGNKAFTLEQITNTGYKGHDALAAFLKAHMKYGKGLPTELQRAL
DSNKGLKQKYQSLLLQKDGPQKGTAQALPAAMYDSEYVVPVQIGTPPQTVPLNLDTGSSDLWTFSTDTNGASVNG
QTLYKPKDSSTSKLQKNESWQIMYGDGAGASGIVYKDRVSIGNTSVESQAVESAVQVSMSLTADQFSSGILGLAN
SAANTVRPTHEKTYIDNIQSDLAQPVFTANLQKARPGNYNFGYINDAEYIKPIQYAALDARSPFWRITVSGYQVA
NLSYKESPWNAIVDTGTSLILAPKEIVQQYYSKLDGSQLDPQQGVVVFPCKNAPPDFFFGIASYRGRVPGNYMNY
GSFNESHCYGGIQSSEGLGFAVLGDVLLKAQFVVFDYGQARVGFANKKTDSSR*
Coding >OphauB2|207
ATGAAAGTCGCACTCTTGTCGCTGGCGCTAGCCTCGCTGGCCGAGAGCGTCGCCCTATCAACAGGACCTAGCTCG
CCCTCGCAGAACCAGCAACCGGGAAACAAGGCCTTTACACTGGAGCAAATCACAAACACTGGCTACAAAGGCCAC
GATGCGCTGGCCGCCTTTCTCAAGGCCCACATGAAGTACGGCAAGGGGCTGCCGACGGAGTTGCAACGAGCGCTG
GATAGCAACAAGGGGCTCAAGCAAAAGTACCAGTCCTTGCTGCTGCAAAAGGATGGACCGCAAAAGGGAACGGCG
CAAGCTCTGCCAGCCGCCATGTATGACTCTGAGTATGTGGTGCCGGTCCAGATTGGCACGCCTCCGCAAACAGTT
CCGCTCAACCTTGACACGGGGTCTTCTGACCTCTGGACCTTTTCCACCGACACAAATGGCGCCTCGGTAAACGGG
CAAACTCTCTACAAGCCCAAAGACTCGTCTACAAGCAAGCTGCAAAAAAATGAGAGCTGGCAAATCATGTACGGC
GACGGCGCAGGCGCCTCGGGCATCGTGTACAAGGACCGCGTCAGCATTGGAAACACGAGCGTGGAAAGCCAGGCT
GTGGAATCCGCCGTGCAAGTCTCCATGTCTCTCACCGCCGACCAGTTCTCCTCGGGCATCCTGGGCCTGGCCAAC
AGCGCGGCAAACACGGTGCGACCAACCCACGAAAAGACATATATTGACAACATCCAAAGCGACCTCGCCCAGCCC
GTCTTTACGGCAAACTTGCAAAAGGCGCGGCCGGGAAACTACAACTTTGGCTACATCAACGACGCCGAATACATC
AAGCCCATTCAGTATGCCGCCCTCGACGCGCGCTCGCCCTTTTGGCGCATCACCGTCTCGGGATACCAAGTGGCC
AATCTAAGCTACAAGGAAAGCCCCTGGAACGCCATTGTCGACACGGGCACCTCGCTCATCCTGGCGCCCAAGGAA
ATCGTCCAGCAGTACTACAGCAAGCTCGACGGCTCTCAGCTCGATCCGCAGCAGGGCGTCGTCGTCTTTCCCTGC
AAGAACGCGCCTCCGGATTTCTTCTTCGGCATTGCCTCGTACCGCGGCCGCGTGCCGGGCAACTACATGAACTAT
GGCAGCTTCAACGAGTCGCATTGCTACGGCGGCATCCAGAGCTCAGAGGGGCTGGGCTTTGCCGTGCTGGGCGAT
GTGTTGCTCAAGGCCCAGTTTGTCGTCTTTGACTATGGCCAGGCTAGAGTGGGCTTTGCTAATAAGAAGACGGAT
AGCTCGCGTTGA
Transcript >OphauB2|207
ATGAAAGTCGCACTCTTGTCGCTGGCGCTAGCCTCGCTGGCCGAGAGCGTCGCCCTATCAACAGGACCTAGCTCG
CCCTCGCAGAACCAGCAACCGGGAAACAAGGCCTTTACACTGGAGCAAATCACAAACACTGGCTACAAAGGCCAC
GATGCGCTGGCCGCCTTTCTCAAGGCCCACATGAAGTACGGCAAGGGGCTGCCGACGGAGTTGCAACGAGCGCTG
GATAGCAACAAGGGGCTCAAGCAAAAGTACCAGTCCTTGCTGCTGCAAAAGGATGGACCGCAAAAGGGAACGGCG
CAAGCTCTGCCAGCCGCCATGTATGACTCTGAGTATGTGGTGCCGGTCCAGATTGGCACGCCTCCGCAAACAGTT
CCGCTCAACCTTGACACGGGGTCTTCTGACCTCTGGACCTTTTCCACCGACACAAATGGCGCCTCGGTAAACGGG
CAAACTCTCTACAAGCCCAAAGACTCGTCTACAAGCAAGCTGCAAAAAAATGAGAGCTGGCAAATCATGTACGGC
GACGGCGCAGGCGCCTCGGGCATCGTGTACAAGGACCGCGTCAGCATTGGAAACACGAGCGTGGAAAGCCAGGCT
GTGGAATCCGCCGTGCAAGTCTCCATGTCTCTCACCGCCGACCAGTTCTCCTCGGGCATCCTGGGCCTGGCCAAC
AGCGCGGCAAACACGGTGCGACCAACCCACGAAAAGACATATATTGACAACATCCAAAGCGACCTCGCCCAGCCC
GTCTTTACGGCAAACTTGCAAAAGGCGCGGCCGGGAAACTACAACTTTGGCTACATCAACGACGCCGAATACATC
AAGCCCATTCAGTATGCCGCCCTCGACGCGCGCTCGCCCTTTTGGCGCATCACCGTCTCGGGATACCAAGTGGCC
AATCTAAGCTACAAGGAAAGCCCCTGGAACGCCATTGTCGACACGGGCACCTCGCTCATCCTGGCGCCCAAGGAA
ATCGTCCAGCAGTACTACAGCAAGCTCGACGGCTCTCAGCTCGATCCGCAGCAGGGCGTCGTCGTCTTTCCCTGC
AAGAACGCGCCTCCGGATTTCTTCTTCGGCATTGCCTCGTACCGCGGCCGCGTGCCGGGCAACTACATGAACTAT
GGCAGCTTCAACGAGTCGCATTGCTACGGCGGCATCCAGAGCTCAGAGGGGCTGGGCTTTGCCGTGCTGGGCGAT
GTGTTGCTCAAGGCCCAGTTTGTCGTCTTTGACTATGGCCAGGCTAGAGTGGGCTTTGCTAATAAGAAGACGGAT
AGCTCGCGTTGA
Gene >OphauB2|207
ATGAAAGTCGCACTCTTGTCGCTGGCGCTAGCCTCGCTGGCCGAGAGCGTCGCCCTATCAACAGGACCTAGCTCG
CCCTCGCAGAACCAGCAACCGGGAAACAAGGCCTTTACACTGGAGCAAATCACAAACACTGGCTACAAAGGCCAC
GATGCGCTGGCCGCCTTTCTCAAGGCCCACATGAAGTACGGCAAGGGGCTGCCGACGGAGTTGCAACGAGCGCTG
GATAGCAACAAGGGGCTCAAGCAAAAGTACCAGTCCTTGCTGCTGCAAAAGGGTATGCTGAGCCGTAGCACCTTG
TTGGAGCTCACGGCAATGGACTAACAGCGTTTATCGAGCAGATGGACCGCAAAAGGGAACGGCGCAAGCTCTGCC
AGCCGCCATGTATGACTCTGAGTATGTGGTGCCGGTCCAGATTGGCACGCCTCCGCAAACAGTTCCGCTCAACCT
TGACACGGGGTCTTCTGACCTGTAAGTTTGCTCATGGCAGCTTGGCACGCGACACCTGACTAACAACAAGGGGGG
GGGGCTTAGCTGGACCTTTTCCACCGACACAAATGGCGCCTCGGTAAACGGGCAAACTCTCTACAAGCCCAAAGA
CTCGTCTACAAGCAAGCTGCAAAAAAATGAGAGCTGGCAAATCATGTACGGCGACGGCGCAGGCGCCTCGGGCAT
CGTGTACAAGGACCGCGTCAGCATTGGAAACACGAGCGTGGAAAGCCAGGCTGTGGAATCCGCCGTGCAAGTCTC
CATGTCTCTCACCGCCGACCAGTTCTCCTCGGGCATCCTGGGCCTGGCCAACAGCGCGGCAAACACGGTGCGACC
AACCCACGAAAAGACATATATTGACAACATCCAAAGCGACCTCGCCCAGCCCGTCTTTACGGCAAACTTGCAAAA
GGCGCGGCCGGGAAACTACAACTTTGGCTACATCAACGACGCCGAATACATCAAGCCCATTCAGTATGCCGCCCT
CGACGCGCGCTCGCCCTTTTGGCGCATCACCGTCTCGGGATACCAAGTGGCCAATCTAAGCTACAAGGAAAGCCC
CTGGAACGCCATTGTCGACACGGGCACCTCGCTCATCCTGGCGCCCAAGGAAATCGTCCAGCAGTACTACAGCAA
GCTCGACGGCTCTCAGCTCGATCCGCAGCAGGGCGTCGTCGTCTTTCCCTGCAAGAACGCGCCTCCGGATTTCTT
CTTCGGCATTGCCTCGTACCGCGGCCGCGTGCCGGGCAACTACATGAACTATGGCAGCTTCAACGAGTCGCATTG
CTACGGCGGCATCCAGAGCTCAGAGGGGCTGGGCTTTGCCGTGCTGGGCGATGTGTTGCTCAAGGCCCAGTTTGT
CGTCTTTGACTATGGCCAGGCTAGAGTGGGCTTTGCTAATAAGAAGACGGATAGCTCGCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail