Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2069
Gene name
LocationContig_161:9468..11999
Strand-
Gene length (bp)2531
Transcript length (bp)2439
Coding sequence length (bp)2439
Protein length (aa) 813

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.3E-10 471 771

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4176
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2929
Ophiocordyceps australis map64 (Brazil) OphauB2|2069 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04532
Ophiocordyceps camponoti-rufipedis Ophun1|5685
Ophiocordyceps kimflemingae Ophio5|2457
Ophiocordyceps subramaniannii Hirsu2|848

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2069
MEANSAVSGSSSEATRQDDQQHHYSQQQQQQHHHYSQHQHQHQQQQHQQHQHQQHQHQQHQHQQHQHQHQHSSSP
SRRAASSGRGGAGIPPASPEVISSLITSLSGAPPLSPPPAASAAKASGVRQSASDSFGMGSDLTYLDHFAASSPI
VRTAPSTLLSTLPRSATHDDGGLGSLLDWPSRPCSRDSLGPDGHGGGLSDKTMFLVDGSPSSVDYTGRAHRSDDD
EAAAASPDGHRGSSTAAASPKPIPDRDSSLGKRSKPKAKARSRRREAVSDVIAEHQGPETRVAAQRTSGAMAERS
FYLGIDDEPSPRSHLALDSDDNADDDFCAPYPSVSNGRWRDKHNHHHHKLSSPALKLKPSSSRLARRSAPGPASP
RSDSPITLGATTCTTTAADAPPRASTSAIERPSSADSIDNDVDACLASPRLSQKVCHAQTGRVISFSEVGDPNGS
AVFCCVGMGLTRFVMAFYDELAQTLKLRLITPDRPGVGESEAYSDGTTTPLSWPDDVYAICQSLKISKFSILAHS
AGAIYALATALRMPQHIRGRIHLLAPWIPPSQMNVFGSQTTPPTNAIPTSQKILRALPTPILKAANSSFMTATSS
SITSSLPKNQRRSKRKTVPTPAPLDVDATAALTLADLRSDEAAANMSNDAAAAAAAATAATTDEAQLARAHTSPG
SPNNHLAAQASARRRAYDARLTNAIWDRATKNANPAVDLLVCLERRHAIGFRYVDITRPVVIHHGSRDSRVPVDN
VRWLGKAMRRCEVRVLEGEGHGLMASASVMGSVLMEVSREWEDWMRATGQREKRKSIVGRAV*
Coding >OphauB2|2069
ATGGAGGCCAATTCTGCAGTGAGCGGCAGCAGCAGCGAGGCGACCCGCCAAGACGATCAGCAGCACCACTATTCG
CAGCAGCAGCAGCAGCAGCACCACCACTACTCGCAGCATCAACATCAGCATCAGCAGCAGCAGCATCAGCAGCAT
CAACATCAGCAGCATCAACATCAGCAGCATCAGCATCAGCAGCATCAGCATCAGCACCAGCATTCTTCTTCGCCG
TCTAGACGAGCTGCGTCGTCGGGTCGAGGTGGCGCTGGGATTCCGCCCGCAAGCCCCGAGGTGATTTCCAGCCTG
ATTACCAGTTTGAGCGGCGCTCCACCTCTGTCTCCTCCCCCGGCAGCCTCTGCGGCCAAGGCGTCGGGCGTCAGG
CAATCTGCTTCCGACAGCTTTGGCATGGGCTCCGACTTGACCTACCTGGACCATTTTGCCGCCTCGTCGCCCATT
GTGCGCACCGCGCCCAGCACCCTCCTCTCGACGCTGCCTCGCTCAGCGACTCACGACGACGGCGGCCTCGGCTCG
CTGCTTGACTGGCCCTCGCGCCCTTGTTCACGGGACTCGCTTGGCCCAGATGGACATGGGGGCGGCCTGTCGGAC
AAGACGATGTTTCTGGTAGATGGCTCGCCGTCGTCTGTCGACTATACTGGCCGAGCGCACAGAAGCGACGACGAC
GAGGCTGCTGCTGCCTCTCCCGACGGACACCGGGGCAGCTCAACGGCAGCGGCCAGCCCCAAGCCAATCCCCGAC
CGGGACTCGAGCCTCGGCAAACGCAGCAAGCCCAAGGCCAAGGCGCGCTCCCGCCGCCGCGAAGCCGTCAGTGAC
GTCATTGCAGAGCATCAAGGGCCCGAGACTCGAGTCGCGGCCCAGAGGACAAGCGGCGCCATGGCGGAGCGCTCC
TTTTACCTGGGCATTGACGACGAGCCGTCTCCACGCTCTCACCTGGCCCTCGACTCGGACGACAATGCCGACGAC
GACTTTTGCGCGCCCTACCCATCAGTCTCCAACGGGCGCTGGCGCGACAAGCACAACCATCACCACCACAAGCTG
AGCAGCCCCGCCCTCAAGCTCAAGCCCAGCTCCTCTCGCCTCGCGCGCCGCTCAGCCCCCGGCCCTGCAAGCCCT
CGCAGCGACTCGCCCATCACCCTCGGCGCCACCACTTGCACCACTACAGCCGCCGACGCCCCGCCCCGCGCCTCC
ACATCTGCCATTGAGCGCCCCAGCTCGGCCGACTCGATTGACAATGACGTCGACGCCTGTCTCGCCTCGCCGCGC
CTCAGCCAAAAGGTGTGCCACGCGCAAACGGGCCGCGTCATTTCCTTTTCCGAGGTGGGCGACCCCAATGGCTCG
GCCGTCTTTTGCTGCGTCGGCATGGGCTTGACGCGCTTCGTCATGGCCTTTTACGACGAGTTGGCCCAGACGCTC
AAGTTGCGTCTCATTACGCCTGATCGTCCGGGCGTGGGCGAAAGCGAGGCCTATTCAGACGGCACCACTACTCCT
CTTAGCTGGCCAGACGACGTCTACGCCATTTGCCAGTCGCTCAAGATTTCAAAGTTTTCCATACTCGCCCACTCT
GCCGGCGCCATTTACGCCCTGGCAACGGCCCTGCGCATGCCGCAGCACATTCGCGGCCGCATCCACCTCCTTGCG
CCCTGGATACCGCCCTCGCAGATGAATGTCTTTGGCTCGCAAACCACGCCCCCCACAAACGCCATTCCCACGTCG
CAAAAGATTCTCCGCGCCCTGCCGACGCCCATCCTAAAGGCTGCAAACTCGAGCTTCATGACGGCCACGAGCAGC
TCCATTACCAGCTCCTTGCCCAAGAACCAGCGCCGCAGCAAGCGAAAGACGGTGCCGACACCTGCGCCGCTTGAT
GTGGATGCCACTGCTGCTCTAACGCTTGCCGACTTGCGCAGCGACGAGGCGGCCGCCAATATGAGCAACGACGCC
GCCGCCGCCGCAGCAGCAGCAACCGCAGCAACAACAGACGAAGCGCAACTCGCCCGCGCACACACCTCGCCCGGC
TCTCCAAACAACCACCTTGCCGCCCAAGCCTCTGCCCGCCGCCGCGCCTACGACGCCCGCCTCACAAACGCCATT
TGGGACCGCGCCACCAAGAATGCCAACCCAGCCGTCGACTTGCTCGTCTGCCTCGAGCGCCGACACGCCATTGGC
TTTCGCTACGTGGACATTACCCGGCCCGTAGTCATCCACCACGGCAGCCGCGACTCGCGCGTGCCCGTGGATAAT
GTGCGCTGGCTGGGCAAGGCGATGCGGCGGTGCGAGGTGCGTGTGCTCGAGGGCGAGGGCCATGGGCTCATGGCG
AGTGCCAGTGTCATGGGGTCGGTGCTCATGGAGGTGAGTCGCGAGTGGGAGGATTGGATGAGGGCGACGGGGCAG
CGGGAAAAGAGGAAGAGTATAGTGGGCAGGGCCGTGTAG
Transcript >OphauB2|2069
ATGGAGGCCAATTCTGCAGTGAGCGGCAGCAGCAGCGAGGCGACCCGCCAAGACGATCAGCAGCACCACTATTCG
CAGCAGCAGCAGCAGCAGCACCACCACTACTCGCAGCATCAACATCAGCATCAGCAGCAGCAGCATCAGCAGCAT
CAACATCAGCAGCATCAACATCAGCAGCATCAGCATCAGCAGCATCAGCATCAGCACCAGCATTCTTCTTCGCCG
TCTAGACGAGCTGCGTCGTCGGGTCGAGGTGGCGCTGGGATTCCGCCCGCAAGCCCCGAGGTGATTTCCAGCCTG
ATTACCAGTTTGAGCGGCGCTCCACCTCTGTCTCCTCCCCCGGCAGCCTCTGCGGCCAAGGCGTCGGGCGTCAGG
CAATCTGCTTCCGACAGCTTTGGCATGGGCTCCGACTTGACCTACCTGGACCATTTTGCCGCCTCGTCGCCCATT
GTGCGCACCGCGCCCAGCACCCTCCTCTCGACGCTGCCTCGCTCAGCGACTCACGACGACGGCGGCCTCGGCTCG
CTGCTTGACTGGCCCTCGCGCCCTTGTTCACGGGACTCGCTTGGCCCAGATGGACATGGGGGCGGCCTGTCGGAC
AAGACGATGTTTCTGGTAGATGGCTCGCCGTCGTCTGTCGACTATACTGGCCGAGCGCACAGAAGCGACGACGAC
GAGGCTGCTGCTGCCTCTCCCGACGGACACCGGGGCAGCTCAACGGCAGCGGCCAGCCCCAAGCCAATCCCCGAC
CGGGACTCGAGCCTCGGCAAACGCAGCAAGCCCAAGGCCAAGGCGCGCTCCCGCCGCCGCGAAGCCGTCAGTGAC
GTCATTGCAGAGCATCAAGGGCCCGAGACTCGAGTCGCGGCCCAGAGGACAAGCGGCGCCATGGCGGAGCGCTCC
TTTTACCTGGGCATTGACGACGAGCCGTCTCCACGCTCTCACCTGGCCCTCGACTCGGACGACAATGCCGACGAC
GACTTTTGCGCGCCCTACCCATCAGTCTCCAACGGGCGCTGGCGCGACAAGCACAACCATCACCACCACAAGCTG
AGCAGCCCCGCCCTCAAGCTCAAGCCCAGCTCCTCTCGCCTCGCGCGCCGCTCAGCCCCCGGCCCTGCAAGCCCT
CGCAGCGACTCGCCCATCACCCTCGGCGCCACCACTTGCACCACTACAGCCGCCGACGCCCCGCCCCGCGCCTCC
ACATCTGCCATTGAGCGCCCCAGCTCGGCCGACTCGATTGACAATGACGTCGACGCCTGTCTCGCCTCGCCGCGC
CTCAGCCAAAAGGTGTGCCACGCGCAAACGGGCCGCGTCATTTCCTTTTCCGAGGTGGGCGACCCCAATGGCTCG
GCCGTCTTTTGCTGCGTCGGCATGGGCTTGACGCGCTTCGTCATGGCCTTTTACGACGAGTTGGCCCAGACGCTC
AAGTTGCGTCTCATTACGCCTGATCGTCCGGGCGTGGGCGAAAGCGAGGCCTATTCAGACGGCACCACTACTCCT
CTTAGCTGGCCAGACGACGTCTACGCCATTTGCCAGTCGCTCAAGATTTCAAAGTTTTCCATACTCGCCCACTCT
GCCGGCGCCATTTACGCCCTGGCAACGGCCCTGCGCATGCCGCAGCACATTCGCGGCCGCATCCACCTCCTTGCG
CCCTGGATACCGCCCTCGCAGATGAATGTCTTTGGCTCGCAAACCACGCCCCCCACAAACGCCATTCCCACGTCG
CAAAAGATTCTCCGCGCCCTGCCGACGCCCATCCTAAAGGCTGCAAACTCGAGCTTCATGACGGCCACGAGCAGC
TCCATTACCAGCTCCTTGCCCAAGAACCAGCGCCGCAGCAAGCGAAAGACGGTGCCGACACCTGCGCCGCTTGAT
GTGGATGCCACTGCTGCTCTAACGCTTGCCGACTTGCGCAGCGACGAGGCGGCCGCCAATATGAGCAACGACGCC
GCCGCCGCCGCAGCAGCAGCAACCGCAGCAACAACAGACGAAGCGCAACTCGCCCGCGCACACACCTCGCCCGGC
TCTCCAAACAACCACCTTGCCGCCCAAGCCTCTGCCCGCCGCCGCGCCTACGACGCCCGCCTCACAAACGCCATT
TGGGACCGCGCCACCAAGAATGCCAACCCAGCCGTCGACTTGCTCGTCTGCCTCGAGCGCCGACACGCCATTGGC
TTTCGCTACGTGGACATTACCCGGCCCGTAGTCATCCACCACGGCAGCCGCGACTCGCGCGTGCCCGTGGATAAT
GTGCGCTGGCTGGGCAAGGCGATGCGGCGGTGCGAGGTGCGTGTGCTCGAGGGCGAGGGCCATGGGCTCATGGCG
AGTGCCAGTGTCATGGGGTCGGTGCTCATGGAGGTGAGTCGCGAGTGGGAGGATTGGATGAGGGCGACGGGGCAG
CGGGAAAAGAGGAAGAGTATAGTGGGCAGGGCCGTGTAG
Gene >OphauB2|2069
ATGGAGGCCAATTCTGCAGTGAGCGGCAGCAGCAGCGAGGCGACCCGCCAAGACGATCAGCAGCACCACTATTCG
CAGCAGCAGCAGCAGCAGCACCACCACTACTCGCAGCATCAACATCAGCATCAGCAGCAGCAGCATCAGCAGCAT
CAACATCAGCAGCATCAACATCAGCAGCATCAGCATCAGCAGCATCAGCATCAGCACCAGCATTCTTCTTCGCCG
TCTAGACGAGCTGCGTCGTCGGGTCGAGGTGGCGCTGGGATTCCGCCCGCAAGCCCCGAGGTGATTTCCAGCCTG
ATTACCAGTTTGAGCGGCGCTCCACCTCTGTCTCCTCCCCCGGCAGCCTCTGCGGCCAAGGCGTCGGGCGTCAGG
CAATCTGCTTCCGACAGCTTTGGCATGGGCTCCGACTTGACCTACCTGGACCATTTTGCCGCCTCGTCGCCCATT
GTGCGCACCGCGCCCAGCACCCTCCTCTCGACGCTGCCTCGCTCAGCGACTCACGACGACGGCGGCCTCGGCTCG
CTGCTTGACTGGCCCTCGCGCCCTTGTTCACGGGACTCGCTTGGCCCAGATGGACATGGGGGCGGCCTGTCGGAC
AAGACGATGTTTCTGGTAGATGGCTCGCCGTCGTCTGTCGACTATACTGGCCGAGCGCACAGAAGCGACGACGAC
GAGGCTGCTGCTGCCTCTCCCGACGGACACCGGGGCAGCTCAACGGCAGCGGCCAGCCCCAAGCCAATCCCCGAC
CGGGACTCGAGCCTCGGCAAACGCAGCAAGCCCAAGGCCAAGGCGCGCTCCCGCCGCCGCGAAGCCGTCAGTGAC
GTCATTGCAGAGCATCAAGGGCCCGAGACTCGAGTCGCGGCCCAGAGGACAAGCGGCGCCATGGCGGAGCGCTCC
TTTTACCTGGGCATTGACGACGAGCCGTCTCCACGCTCTCACCTGGCCCTCGACTCGGACGACAATGCCGACGAC
GACTTTTGCGCGCCCTACCCATCAGTCTCCAACGGGCGCTGGCGCGACAAGCACAACCATCACCACCACAAGCTG
AGCAGCCCCGCCCTCAAGCTCAAGCCCAGCTCCTCTCGCCTCGCGCGCCGCTCAGCCCCCGGCCCTGCAAGCCCT
CGCAGCGACTCGCCCATCACCCTCGGCGCCACCACTTGCACCACTACAGCCGCCGACGCCCCGCCCCGCGCCTCC
ACATCTGCCATTGAGCGCCCCAGCTCGGCCGACTCGATTGACAATGACGTCGACGCCTGTCTCGCCTCGCCGCGC
CTCAGCCAAAAGGTGTGCCACGCGCAAACGGGCCGCGTCATTTCCTTTTCCGAGGTGGGCGACCCCAATGGCTCG
GCCGTCTTTTGCTGCGTCGGCATGGGCTTGACGCGCTTCGTCATGGCCTTTTACGACGAGTTGGCCCAGACGCTC
AAGTTGCGTCTCATTACGCCTGATCGTCCGGGCGTGGGCGAAAGCGAGGCCTATTCAGACGGCACCACTACTCCT
CTTAGCTGGCCAGGTCTGCACCCCCTTTTTTACTCTTGATCTTGCTCCCTTTTCCTGTAAAATTATTTGCGTGTA
CAAAAATCCTAACGACAAGTAATGCTCTAGACGACGTCTACGCCATTTGCCAGTCGCTCAAGATTTCAAAGTTTT
CCATACTCGCCCACTCTGCCGGCGCCATTTACGCCCTGGCAACGGCCCTGCGCATGCCGCAGCACATTCGCGGCC
GCATCCACCTCCTTGCGCCCTGGATACCGCCCTCGCAGATGAATGTCTTTGGCTCGCAAACCACGCCCCCCACAA
ACGCCATTCCCACGTCGCAAAAGATTCTCCGCGCCCTGCCGACGCCCATCCTAAAGGCTGCAAACTCGAGCTTCA
TGACGGCCACGAGCAGCTCCATTACCAGCTCCTTGCCCAAGAACCAGCGCCGCAGCAAGCGAAAGACGGTGCCGA
CACCTGCGCCGCTTGATGTGGATGCCACTGCTGCTCTAACGCTTGCCGACTTGCGCAGCGACGAGGCGGCCGCCA
ATATGAGCAACGACGCCGCCGCCGCCGCAGCAGCAGCAACCGCAGCAACAACAGACGAAGCGCAACTCGCCCGCG
CACACACCTCGCCCGGCTCTCCAAACAACCACCTTGCCGCCCAAGCCTCTGCCCGCCGCCGCGCCTACGACGCCC
GCCTCACAAACGCCATTTGGGACCGCGCCACCAAGAATGCCAACCCAGCCGTCGACTTGCTCGTCTGCCTCGAGC
GCCGACACGCCATTGGCTTTCGCTACGTGGACATTACCCGGCCCGTAGTCATCCACCACGGCAGCCGCGACTCGC
GCGTGCCCGTGGATAATGTGCGCTGGCTGGGCAAGGCGATGCGGCGGTGCGAGGTGCGTGTGCTCGAGGGCGAGG
GCCATGGGCTCATGGCGAGTGCCAGTGTCATGGGGTCGGTGCTCATGGAGGTGAGTCGCGAGTGGGAGGATTGGA
TGAGGGCGACGGGGCAGCGGGAAAAGAGGAAGAGTATAGTGGGCAGGGCCGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail