Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2064
Gene name
LocationContig_161:1554..2097
Strand+
Gene length (bp)543
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 2.0E-23 26 144

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8TG42|MP1_ASPFL Cell wall mannoprotein 1 OS=Aspergillus flavus GN=mp1 PE=2 SV=1 4 155 1.0E-09
sp|Q9HFP8|MP1_ASPFM Cell wall mannoprotein 1 OS=Neosartorya fumigata GN=MP1 PE=1 SV=1 1 162 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2064
MKFFSQLTAVCLATGAYAAALVPRDAQTIKDVLGRVQGGVDNLDGTVKQFNGDVGPILSSADSLVATIRTGSDDV
RNTAPVTDLNDAFSILGPVDELKQHVRTLADDFNAKKNDVSSAKQCGTTRGKLDDIGTNTKTLIDLIVSKVPPST
QGIARDRGKQITDILDEVKANYAADKCVDA*
Coding >OphauB2|2064
ATGAAGTTCTTTTCCCAACTCACCGCCGTCTGCCTCGCCACTGGCGCCTATGCCGCCGCTCTTGTCCCCCGTGAC
GCTCAGACCATCAAGGACGTCCTTGGCAGAGTGCAGGGCGGCGTCGACAACCTGGACGGCACCGTCAAGCAGTTC
AACGGCGACGTAGGCCCCATCTTGTCGTCTGCCGACAGCCTCGTTGCCACCATTCGCACCGGCAGCGACGACGTC
CGGAACACGGCACCAGTCACTGATCTCAACGATGCCTTTTCCATCCTCGGTCCCGTTGACGAGCTCAAGCAGCAC
GTCCGGACTTTGGCTGATGACTTCAACGCCAAGAAGAATGATGTTTCCAGCGCCAAGCAGTGCGGAACGACGCGC
GGCAAGCTTGATGACATTGGCACCAACACAAAGACTTTGATTGACTTGATTGTCTCCAAGGTCCCGCCATCTACT
CAGGGCATCGCCAGGGACCGCGGCAAGCAAATCACTGACATTCTCGACGAGGTCAAGGCCAACTATGCTGCTGAC
AAGTGCGTCGATGCTTAA
Transcript >OphauB2|2064
ATGAAGTTCTTTTCCCAACTCACCGCCGTCTGCCTCGCCACTGGCGCCTATGCCGCCGCTCTTGTCCCCCGTGAC
GCTCAGACCATCAAGGACGTCCTTGGCAGAGTGCAGGGCGGCGTCGACAACCTGGACGGCACCGTCAAGCAGTTC
AACGGCGACGTAGGCCCCATCTTGTCGTCTGCCGACAGCCTCGTTGCCACCATTCGCACCGGCAGCGACGACGTC
CGGAACACGGCACCAGTCACTGATCTCAACGATGCCTTTTCCATCCTCGGTCCCGTTGACGAGCTCAAGCAGCAC
GTCCGGACTTTGGCTGATGACTTCAACGCCAAGAAGAATGATGTTTCCAGCGCCAAGCAGTGCGGAACGACGCGC
GGCAAGCTTGATGACATTGGCACCAACACAAAGACTTTGATTGACTTGATTGTCTCCAAGGTCCCGCCATCTACT
CAGGGCATCGCCAGGGACCGCGGCAAGCAAATCACTGACATTCTCGACGAGGTCAAGGCCAACTATGCTGCTGAC
AAGTGCGTCGATGCTTAA
Gene >OphauB2|2064
ATGAAGTTCTTTTCCCAACTCACCGCCGTCTGCCTCGCCACTGGCGCCTATGCCGCCGCTCTTGTCCCCCGTGAC
GCTCAGACCATCAAGGACGTCCTTGGCAGAGTGCAGGGCGGCGTCGACAACCTGGACGGCACCGTCAAGCAGTTC
AACGGCGACGTAGGCCCCATCTTGTCGTCTGCCGACAGCCTCGTTGCCACCATTCGCACCGGCAGCGACGACGTC
CGGAACACGGCACCAGTCACTGATCTCAACGATGCCTTTTCCATCCTCGGTCCCGTTGACGAGCTCAAGCAGCAC
GTCCGGACTTTGGCTGATGACTTCAACGCCAAGAAGAATGATGTTTCCAGCGCCAAGCAGTGCGGAACGACGCGC
GGCAAGCTTGATGACATTGGCACCAACACAAAGACTTTGATTGACTTGATTGTCTCCAAGGTCCCGCCATCTACT
CAGGGCATCGCCAGGGACCGCGGCAAGCAAATCACTGACATTCTCGACGAGGTCAAGGCCAACTATGCTGCTGAC
AAGTGCGTCGATGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail