Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2056
Gene name
LocationContig_160:19926..23310
Strand+
Gene length (bp)3384
Transcript length (bp)3150
Coding sequence length (bp)3150
Protein length (aa) 1050

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01465 GRIP GRIP domain 6.3E-17 997 1039

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q75AF5|IMH1_ASHGO Golgin IMH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IMH1 PE=3 SV=2 480 1044 6.0E-19
sp|Q06704|IMH1_YEAST Golgin IMH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMH1 PE=1 SV=1 762 1044 1.0E-10
sp|Q75AF5|IMH1_ASHGO Golgin IMH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IMH1 PE=3 SV=2 118 220 2.0E-09
sp|Q00174|LAMA_DROME Laminin subunit alpha OS=Drosophila melanogaster GN=LanA PE=1 SV=2 500 968 2.0E-08
sp|O42657|YF82_SCHPO GRIP and coiled-coil domain-containing protein C27D7.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27D7.02c PE=3 SV=1 677 1038 4.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1812
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7751
Ophiocordyceps australis map64 (Brazil) OphauB2|2056 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02926
Ophiocordyceps camponoti-rufipedis Ophun1|1172
Ophiocordyceps kimflemingae Ophio5|7184
Ophiocordyceps subramaniannii Hirsu2|1783

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2056
MFQRIRGAIDRTIAEEQARQRSTLDASGSATPSRSASTSSRRAARTKTAAALPDAPNPDPAVFEAAFVIDDSDDA
SRAGTPKPLPREKEAADAMPLSNGAHDARRESEAGREGAADEGQGASELSPEVKQRLRKLEKLEATYPELLRSYR
VAHRRATAIEPFEKALRENTPLTSITDPGALTEYLNQLALRSDMVMDELKKVSSDRDDLKTKYTESQDKLGRLES
ELNTLKSAAGPKAKSQDEDKAQDQDFFSYDDEMPKLEAQVAAKSAQIEKLEATVENLTKQLDALRQDGRDTQDAP
RNEASTEQASLLEQLQARTKEIDSLKTSLEQAQAQLTKLEDEARADKQASQTKAKEIEASLATSDKRAADLDAQL
SKANAAKALSKKLIDDLNAKVEEMKKEKAAEAQSRQAQPTEAAAAPVAAAAASTPAPTAAAGSGASKKKKKQKKA
KGGASSGSAATAVATPEEESTPVQAPPATQLAAEIAKLEQEIKDKDSQIEALSRQRKTAQELGEEVESLQENLIN
IGQDHVEAKNQIKELQADKESLASQVSALEQKLGASGGKSEDSLGPLQEEYEQVKTKLADLQSDLGAAQQLAQSR
FKELTELREAVEKAQPELKKLRQESAELKTVRETLAAKSKELQETDKREKELEQQVGRVQKLLADGEAEVKRQSQ
KLAAESASKQEAEEGKRSAERSLRRAEADKIELSAKAEKTERELSKTQEQGKQLRARVKELEEQVHTGRREKAAA
QEEAEFKAQQYSNAQGLLSSMRDQTAEMTTQLKEAQGQAEAAEEELSEVRRLLQERTGEGETMRRLLADVDARAE
GQVTEMRERLERAVEERDKIEDEGRLAVRRRTREAEELRQRIKELERESKNAAREQQDIAEQQQLWEKQRELVQQ
EEAKAEAEAAEARTAVSQLRAALEASERQVRQQQVGEGELRRALDEAQQRCEKGARELRAAQGRLSSMAAAGGGS
PTRRGSVESSRSGGGGGGGAATDTMYLKTILLQFLEQKDGKLRAQLVPVLGKLLKFDKSDEQKWINAVQHMGVR*
Coding >OphauB2|2056
ATGTTTCAGAGAATCCGCGGCGCCATTGACAGAACCATTGCCGAAGAACAGGCCCGTCAGCGCAGCACCCTCGAC
GCCAGCGGCTCCGCGACGCCCTCACGCTCTGCCTCGACGTCGTCTCGCCGCGCCGCTCGCACCAAGACAGCAGCC
GCCTTGCCCGACGCGCCCAATCCCGACCCTGCAGTCTTTGAGGCGGCCTTTGTCATTGACGATAGCGACGATGCT
AGCCGCGCCGGCACGCCTAAGCCGCTGCCTCGGGAAAAGGAGGCGGCCGATGCTATGCCGCTGAGTAATGGCGCC
CATGATGCGAGGCGCGAGAGCGAGGCGGGCAGAGAGGGCGCGGCGGATGAGGGCCAGGGCGCTTCCGAGCTGTCG
CCCGAGGTGAAGCAGCGGCTGCGCAAGCTGGAAAAGCTCGAGGCGACGTATCCCGAATTGTTGAGATCGTATAGA
GTTGCACATAGACGAGCAACGGCCATTGAGCCATTTGAAAAGGCACTGCGGGAGAATACGCCTCTAACGTCTATT
ACTGACCCCGGGGCGCTGACGGAATATCTTAACCAACTCGCTCTACGCAGCGACATGGTCATGGACGAGCTTAAA
AAGGTCTCTTCCGACAGGGACGACCTCAAGACCAAGTATACAGAGTCGCAAGACAAACTCGGGCGTCTAGAGTCT
GAGCTCAACACTCTAAAGTCTGCTGCTGGCCCCAAGGCCAAGAGCCAAGATGAAGACAAGGCTCAAGACCAAGAT
TTTTTTTCCTACGACGACGAAATGCCCAAGCTCGAGGCTCAAGTGGCGGCCAAGTCGGCCCAAATTGAAAAGCTC
GAGGCTACCGTTGAAAACTTGACCAAACAACTAGATGCTTTGCGACAAGATGGCAGAGACACCCAAGACGCGCCC
CGCAATGAAGCCTCTACCGAGCAAGCATCATTGCTAGAGCAACTACAAGCACGCACCAAGGAAATAGACAGCCTA
AAGACAAGCCTCGAGCAAGCACAGGCCCAGCTCACCAAGCTCGAGGACGAGGCACGTGCGGACAAGCAAGCCAGC
CAAACCAAGGCCAAGGAAATCGAGGCATCTCTTGCCACCTCGGACAAGCGGGCAGCAGACCTGGACGCTCAGCTG
AGCAAAGCAAATGCCGCCAAGGCATTATCCAAGAAACTCATTGATGATCTCAATGCCAAGGTTGAAGAGATGAAG
AAGGAAAAGGCGGCCGAGGCCCAATCAAGGCAAGCTCAGCCGACTGAGGCAGCAGCAGCACCAGTGGCTGCGGCG
GCGGCTTCTACTCCTGCTCCTACAGCTGCAGCGGGCAGTGGTGCGTCCAAGAAGAAGAAGAAACAAAAAAAGGCC
AAGGGCGGTGCTTCGTCTGGGTCTGCAGCAACAGCTGTTGCCACGCCAGAGGAGGAGTCTACACCCGTGCAAGCT
CCACCGGCTACACAGCTCGCAGCCGAGATTGCCAAGCTCGAGCAAGAAATAAAGGACAAGGACAGCCAGATTGAA
GCGCTGTCAAGGCAGCGCAAAACAGCGCAAGAGCTGGGGGAAGAAGTCGAGTCGCTTCAAGAGAATTTAATCAAT
ATTGGACAAGACCACGTTGAAGCCAAGAATCAGATCAAGGAGCTACAAGCCGACAAGGAATCGCTGGCCAGCCAA
GTGTCTGCGCTAGAGCAAAAGCTTGGCGCTTCAGGTGGCAAGTCGGAGGATAGCTTGGGGCCACTGCAAGAGGAA
TACGAGCAAGTCAAGACAAAGTTGGCAGACCTACAGTCGGACCTGGGAGCCGCGCAGCAGCTGGCACAGTCACGC
TTCAAGGAGCTGACGGAGCTACGCGAGGCTGTGGAAAAGGCGCAGCCCGAGTTGAAGAAGCTTCGACAAGAGTCA
GCAGAGCTCAAGACGGTGAGGGAGACTCTTGCAGCAAAGAGCAAGGAGCTGCAAGAGACGGACAAGAGGGAAAAG
GAGCTTGAGCAGCAAGTAGGCCGAGTGCAAAAGCTCTTGGCTGATGGCGAGGCCGAGGTTAAGCGGCAGTCGCAA
AAGCTTGCTGCCGAGAGCGCAAGCAAGCAAGAGGCTGAAGAGGGCAAGCGCAGCGCGGAGCGCAGTCTACGGCGG
GCAGAAGCAGACAAGATTGAGCTGAGCGCCAAGGCGGAAAAGACGGAGCGGGAGCTGAGCAAGACGCAAGAGCAA
GGCAAGCAGCTGCGGGCGCGGGTCAAGGAGCTGGAGGAGCAAGTGCACACGGGGCGGCGGGAAAAGGCGGCAGCG
CAGGAAGAGGCCGAGTTCAAGGCGCAGCAGTACAGCAACGCGCAGGGCCTGCTGAGCAGCATGCGCGACCAGACG
GCGGAGATGACGACACAGCTCAAGGAGGCGCAAGGGCAGGCCGAGGCGGCGGAGGAGGAGCTGAGCGAAGTGCGG
CGGCTACTACAGGAGCGGACGGGCGAGGGCGAGACGATGCGGCGGCTGCTGGCGGATGTGGACGCGCGAGCCGAG
GGCCAAGTAACGGAGATGCGAGAGCGGCTGGAGAGGGCGGTGGAGGAGCGCGACAAGATTGAAGACGAGGGCCGG
CTGGCAGTGCGGCGGCGGACGCGCGAAGCCGAAGAGCTGCGGCAGCGCATCAAGGAGCTGGAGCGGGAGAGCAAG
AATGCAGCGCGGGAGCAGCAAGACATTGCGGAGCAGCAGCAGCTATGGGAGAAGCAGCGCGAGCTGGTGCAGCAA
GAGGAAGCCAAGGCCGAGGCCGAGGCGGCAGAGGCGCGCACGGCGGTGAGCCAGCTGCGTGCGGCGCTCGAGGCG
TCGGAGCGGCAGGTGCGGCAGCAGCAAGTGGGCGAGGGGGAGCTGCGGCGGGCGCTCGACGAGGCGCAGCAGCGG
TGCGAAAAGGGGGCACGGGAGCTGCGGGCGGCGCAGGGCAGGCTGTCGTCCATGGCGGCGGCGGGCGGAGGCAGT
CCGACGCGGCGCGGGTCCGTCGAGTCGAGCCGGAGTGGCGGCGGCGGAGGCGGAGGAGCGGCGACGGATACCATG
TATCTCAAGACGATTTTGCTGCAGTTTTTGGAGCAAAAGGACGGCAAGCTGAGGGCGCAGCTGGTGCCTGTTCTC
GGCAAGCTGCTCAAGTTTGACAAAAGCGACGAGCAGAAATGGATCAATGCCGTGCAACACATGGGTGTGCGGTGA
Transcript >OphauB2|2056
ATGTTTCAGAGAATCCGCGGCGCCATTGACAGAACCATTGCCGAAGAACAGGCCCGTCAGCGCAGCACCCTCGAC
GCCAGCGGCTCCGCGACGCCCTCACGCTCTGCCTCGACGTCGTCTCGCCGCGCCGCTCGCACCAAGACAGCAGCC
GCCTTGCCCGACGCGCCCAATCCCGACCCTGCAGTCTTTGAGGCGGCCTTTGTCATTGACGATAGCGACGATGCT
AGCCGCGCCGGCACGCCTAAGCCGCTGCCTCGGGAAAAGGAGGCGGCCGATGCTATGCCGCTGAGTAATGGCGCC
CATGATGCGAGGCGCGAGAGCGAGGCGGGCAGAGAGGGCGCGGCGGATGAGGGCCAGGGCGCTTCCGAGCTGTCG
CCCGAGGTGAAGCAGCGGCTGCGCAAGCTGGAAAAGCTCGAGGCGACGTATCCCGAATTGTTGAGATCGTATAGA
GTTGCACATAGACGAGCAACGGCCATTGAGCCATTTGAAAAGGCACTGCGGGAGAATACGCCTCTAACGTCTATT
ACTGACCCCGGGGCGCTGACGGAATATCTTAACCAACTCGCTCTACGCAGCGACATGGTCATGGACGAGCTTAAA
AAGGTCTCTTCCGACAGGGACGACCTCAAGACCAAGTATACAGAGTCGCAAGACAAACTCGGGCGTCTAGAGTCT
GAGCTCAACACTCTAAAGTCTGCTGCTGGCCCCAAGGCCAAGAGCCAAGATGAAGACAAGGCTCAAGACCAAGAT
TTTTTTTCCTACGACGACGAAATGCCCAAGCTCGAGGCTCAAGTGGCGGCCAAGTCGGCCCAAATTGAAAAGCTC
GAGGCTACCGTTGAAAACTTGACCAAACAACTAGATGCTTTGCGACAAGATGGCAGAGACACCCAAGACGCGCCC
CGCAATGAAGCCTCTACCGAGCAAGCATCATTGCTAGAGCAACTACAAGCACGCACCAAGGAAATAGACAGCCTA
AAGACAAGCCTCGAGCAAGCACAGGCCCAGCTCACCAAGCTCGAGGACGAGGCACGTGCGGACAAGCAAGCCAGC
CAAACCAAGGCCAAGGAAATCGAGGCATCTCTTGCCACCTCGGACAAGCGGGCAGCAGACCTGGACGCTCAGCTG
AGCAAAGCAAATGCCGCCAAGGCATTATCCAAGAAACTCATTGATGATCTCAATGCCAAGGTTGAAGAGATGAAG
AAGGAAAAGGCGGCCGAGGCCCAATCAAGGCAAGCTCAGCCGACTGAGGCAGCAGCAGCACCAGTGGCTGCGGCG
GCGGCTTCTACTCCTGCTCCTACAGCTGCAGCGGGCAGTGGTGCGTCCAAGAAGAAGAAGAAACAAAAAAAGGCC
AAGGGCGGTGCTTCGTCTGGGTCTGCAGCAACAGCTGTTGCCACGCCAGAGGAGGAGTCTACACCCGTGCAAGCT
CCACCGGCTACACAGCTCGCAGCCGAGATTGCCAAGCTCGAGCAAGAAATAAAGGACAAGGACAGCCAGATTGAA
GCGCTGTCAAGGCAGCGCAAAACAGCGCAAGAGCTGGGGGAAGAAGTCGAGTCGCTTCAAGAGAATTTAATCAAT
ATTGGACAAGACCACGTTGAAGCCAAGAATCAGATCAAGGAGCTACAAGCCGACAAGGAATCGCTGGCCAGCCAA
GTGTCTGCGCTAGAGCAAAAGCTTGGCGCTTCAGGTGGCAAGTCGGAGGATAGCTTGGGGCCACTGCAAGAGGAA
TACGAGCAAGTCAAGACAAAGTTGGCAGACCTACAGTCGGACCTGGGAGCCGCGCAGCAGCTGGCACAGTCACGC
TTCAAGGAGCTGACGGAGCTACGCGAGGCTGTGGAAAAGGCGCAGCCCGAGTTGAAGAAGCTTCGACAAGAGTCA
GCAGAGCTCAAGACGGTGAGGGAGACTCTTGCAGCAAAGAGCAAGGAGCTGCAAGAGACGGACAAGAGGGAAAAG
GAGCTTGAGCAGCAAGTAGGCCGAGTGCAAAAGCTCTTGGCTGATGGCGAGGCCGAGGTTAAGCGGCAGTCGCAA
AAGCTTGCTGCCGAGAGCGCAAGCAAGCAAGAGGCTGAAGAGGGCAAGCGCAGCGCGGAGCGCAGTCTACGGCGG
GCAGAAGCAGACAAGATTGAGCTGAGCGCCAAGGCGGAAAAGACGGAGCGGGAGCTGAGCAAGACGCAAGAGCAA
GGCAAGCAGCTGCGGGCGCGGGTCAAGGAGCTGGAGGAGCAAGTGCACACGGGGCGGCGGGAAAAGGCGGCAGCG
CAGGAAGAGGCCGAGTTCAAGGCGCAGCAGTACAGCAACGCGCAGGGCCTGCTGAGCAGCATGCGCGACCAGACG
GCGGAGATGACGACACAGCTCAAGGAGGCGCAAGGGCAGGCCGAGGCGGCGGAGGAGGAGCTGAGCGAAGTGCGG
CGGCTACTACAGGAGCGGACGGGCGAGGGCGAGACGATGCGGCGGCTGCTGGCGGATGTGGACGCGCGAGCCGAG
GGCCAAGTAACGGAGATGCGAGAGCGGCTGGAGAGGGCGGTGGAGGAGCGCGACAAGATTGAAGACGAGGGCCGG
CTGGCAGTGCGGCGGCGGACGCGCGAAGCCGAAGAGCTGCGGCAGCGCATCAAGGAGCTGGAGCGGGAGAGCAAG
AATGCAGCGCGGGAGCAGCAAGACATTGCGGAGCAGCAGCAGCTATGGGAGAAGCAGCGCGAGCTGGTGCAGCAA
GAGGAAGCCAAGGCCGAGGCCGAGGCGGCAGAGGCGCGCACGGCGGTGAGCCAGCTGCGTGCGGCGCTCGAGGCG
TCGGAGCGGCAGGTGCGGCAGCAGCAAGTGGGCGAGGGGGAGCTGCGGCGGGCGCTCGACGAGGCGCAGCAGCGG
TGCGAAAAGGGGGCACGGGAGCTGCGGGCGGCGCAGGGCAGGCTGTCGTCCATGGCGGCGGCGGGCGGAGGCAGT
CCGACGCGGCGCGGGTCCGTCGAGTCGAGCCGGAGTGGCGGCGGCGGAGGCGGAGGAGCGGCGACGGATACCATG
TATCTCAAGACGATTTTGCTGCAGTTTTTGGAGCAAAAGGACGGCAAGCTGAGGGCGCAGCTGGTGCCTGTTCTC
GGCAAGCTGCTCAAGTTTGACAAAAGCGACGAGCAGAAATGGATCAATGCCGTGCAACACATGGGTGTGCGGTGA
Gene >OphauB2|2056
ATGTTTCAGGTGCGCAGCCCATGCTTGTTCCTCTTTTGGAAGCCGATGCTGCCTCGTCGCAAGCCCCAGCCAAAG
CAACTAATTCCTCGAGCCTTAGAGAATCCGCGGCGCCATTGACAGAACCATTGCCGAAGAACAGGCCCGTCAGCG
CAGCACCCTCGACGCCAGCGGCTCCGCGACGCCCTCACGCTCTGCCTCGACGTCGTCTCGCCGCGCCGCTCGCAC
CAAGACAGCAGCCGCCTTGCCCGACGCGCCCAATCCCGACCCTGCAGTCTTTGAGGCGGCCTTTGTCATTGACGA
TAGCGACGATGCTAGCCGCGCCGGCACGCCTAAGCCGCTGCCTCGGGAAAAGGAGGCGGCCGATGCTATGCCGCT
GAGTAATGGCGCCCATGATGCGAGGCGCGAGAGCGAGGCGGGCAGAGAGGGCGCGGCGGATGAGGGCCAGGGCGC
TTCCGAGCTGTCGCCCGAGGTGAAGCAGCGGCTGCGCAAGCTGGAAAAGCTCGAGGCGACGTATCCCGGTAAGCA
GTCGTAGGAGCCAGGCAAGCGTGGTTGAGGCTGACGTGGGTGCAGAATTGTTGAGATCGTATAGAGTTGCACATA
GACGAGCAACGGCCATTGAGCCATTTGAAAAGGCACTGCGGGAGAATACGCCTCTAACGTCTATTACTGACCCCG
GGGCGCTGACGGAATATCTTAACCAACTCGCTCTACGCAGCGACATGGTCATGGACGAGCTTAAAAAGGTCTCTT
CCGACAGGGACGACCTCAAGACCAAGTATACAGAGTCGCAAGACAAACTCGGGCGTCTAGAGTCTGAGCTCAACA
CTCTAAAGTCTGCTGCTGGCCCCAAGGCCAAGAGCCAAGATGAAGACAAGGCTCAAGACCAAGATTTTTTTTCCT
ACGACGACGAAATGCCCAAGCTCGAGGCTCAAGTGGCGGCCAAGTCGGCCCAAATTGAAAAGCTCGAGGCTACCG
TTGAAAACTTGACCAAACAACTAGATGCTTTGCGACAAGATGGCAGAGACACCCAAGACGCGCCCCGCAATGAAG
CCTCTACCGAGCAAGCATCATTGCTAGAGCAACTACAAGCACGCACCAAGGAAATAGACAGCCTAAAGACAAGCC
TCGAGCAAGCACAGGCCCAGCTCACCAAGCTCGAGGACGAGGCACGTGCGGACAAGCAAGCCAGCCAAACCAAGG
CCAAGGAAATCGAGGCATCTCTTGCCACCTCGGACAAGCGGGCAGCAGACCTGGACGCTCAGCTGAGCAAAGCAA
ATGCCGCCAAGGCATTATCCAAGAAACTCATTGATGATCTCAATGCCAAGGTTGAAGAGATGAAGAAGGAAAAGG
CGGCCGAGGCCCAATCAAGGCAAGCTCAGCCGACTGAGGCAGCAGCAGCACCAGTGGCTGCGGCGGCGGCTTCTA
CTCCTGCTCCTACAGCTGCAGCGGGCAGTGGTGCGTCCAAGAAGAAGAAGAAACAAAAAAAGGCCAAGGGCGGTG
CTTCGTCTGGGTCTGCAGCAACAGCTGTTGCCACGCCAGAGGAGGAGTCTACACCCGTGCAAGCTCCACCGGCTA
CACAGCTCGCAGCCGAGATTGCCAAGCTCGAGCAAGAAATAAAGGACAAGGACAGCCAGATTGAAGCGCTGTCAA
GGCAGCGCAAAACAGCGCAAGAGCTGGGGGAAGAAGTCGAGTCGCTTCAAGAGAATTTAATCAATATTGGACAAG
ACCACGTTGAAGCCAAGAATCAGATCAAGGAGCTACAAGCCGACAAGGAATCGCTGGCCAGCCAAGTGTCTGCGC
TAGAGCAAAAGCTTGGCGCTTCAGGTGGCAAGTCGGAGGATAGCTTGGGGCCACTGCAAGAGGAATACGAGCAAG
TCAAGACAAAGTTGGCAGACCTACAGTCGGACCTGGGAGCCGCGCAGCAGCTGGCACAGTCACGCTTCAAGGAGC
TGACGGAGCTACGCGAGGCTGTGGAAAAGGCGCAGCCCGAGTTGAAGAAGCTTCGACAAGAGTCAGCAGAGCTCA
AGACGGTGAGGGAGACTCTTGCAGCAAAGAGCAAGGAGCTGCAAGAGACGGACAAGAGGGAAAAGGAGCTTGAGC
AGCAAGTAGGCCGAGTGCAAAAGCTCTTGGCTGATGGCGAGGCCGAGGTTAAGCGGCAGTCGCAAAAGCTTGCTG
CCGAGAGCGCAAGCAAGCAAGAGGCTGAAGAGGGCAAGCGCAGCGCGGAGCGCAGTCTACGGCGGGCAGAAGCAG
ACAAGATTGAGCTGAGCGCCAAGGCGGAAAAGACGGAGCGGGAGCTGAGCAAGACGCAAGAGCAAGGCAAGCAGC
TGCGGGCGCGGGTCAAGGAGCTGGAGGAGCAAGTGCACACGGGGCGGCGGGAAAAGGCGGCAGCGCAGGAAGAGG
CCGAGTTCAAGGCGCAGCAGTACAGCAACGCGCAGGGCCTGCTGAGCAGCATGCGCGACCAGACGGCGGAGATGA
CGACACAGCTCAAGGAGGCGCAAGGGCAGGCCGAGGCGGCGGAGGAGGAGCTGAGCGAAGTGCGGCGGCTACTAC
AGGAGCGGACGGGCGAGGGCGAGACGATGCGGCGGCTGCTGGCGGATGTGGACGCGCGAGCCGAGGGCCAAGTAA
CGGAGATGCGAGAGCGGCTGGAGAGGGCGGTGGAGGAGCGCGACAAGATTGAAGACGAGGGCCGGCTGGCAGTGC
GGCGGCGGACGCGCGAAGCCGAAGAGCTGCGGCAGCGCATCAAGGAGCTGGAGCGGGAGAGCAAGAATGCAGCGC
GGGAGCAGCAAGACATTGCGGAGCAGCAGCAGCTATGGGAGAAGCAGCGCGAGCTGGTGCAGCAAGAGGAAGCCA
AGGCCGAGGCCGAGGCGGCAGAGGCGCGCACGGCGGTGAGCCAGCTGCGTGCGGCGCTCGAGGCGTCGGAGCGGC
AGGTGCGGCAGCAGCAAGTGGGCGAGGGGGAGCTGCGGCGGGCGCTCGACGAGGCGCAGCAGCGGTGCGAAAAGG
GGGCACGGGAGCTGCGGGCGGCGCAGGGCAGGCTGTCGTCCATGGCGGCGGCGGGCGGAGGCAGTCCGACGCGGC
GCGGGTCCGTCGAGTCGAGCCGGAGTGGCGGCGGCGGAGGCGGAGGAGCGGCGACGGATACCATGTATCTCAAGA
CGATTTTGCTGCAGTTTTTGGAGCAAAAGGACGGCAAGCTGAGGGCGCAGCTGGTGCCTGTTCTCGGCAAGCTGC
TCAAGTTTGACAAGTGAGTTTTTTTTTTTTTTCCCTTTTTCCTCTTTTTCCTTGACGTCACTGCAAATATTGTGG
CAAAACAAAAAAAAAACTGACGCCTCTTGAAGAAGCGACGAGCAGAAATGGATCAATGCCGTGCAACACATGGGT
GTGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail