Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2054
Gene name
LocationContig_160:13344..16735
Strand+
Gene length (bp)3391
Transcript length (bp)2565
Coding sequence length (bp)2565
Protein length (aa) 855

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.1E-152 132 805

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 84 844 7.0E-130
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 29 828 1.0E-126
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 111 823 1.0E-114
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 111 846 2.0E-103
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 100 820 2.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 84 844 7.0E-130
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 29 828 1.0E-126
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 111 823 1.0E-114
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 111 846 2.0E-103
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 100 820 2.0E-102
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 94 817 1.0E-98
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 110 839 3.0E-98
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 99 817 4.0E-93
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 110 818 2.0E-92
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 115 825 9.0E-90
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 91 843 9.0E-88
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 115 839 4.0E-87
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 33 826 5.0E-77
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 116 826 2.0E-75
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0042887 amide transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 134 156 22
2 212 234 22
3 249 271 22
4 317 336 19
5 346 368 22
6 389 411 22
7 462 484 22
8 529 551 22
9 566 588 22
10 601 623 22
11 638 657 19
12 707 726 19
13 750 772 22
14 784 806 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2054
MKPASSNDSLLQADDSGDERNRDAEKSTRIDADARRLDPSKDEILEAEEVAACMTLERAQLILQETVKTHSGDPN
FPFSTLCTIKEYLSCNDIDDALAHRIKLQASLLYNNSPYPEVRGVVDNHDDPLLPASTLRAWTLGIFFSMLVAAV
NQLFSIRQPGIGIGGTIVQLLAFPLGKAWERWMPRRELCIPFTRHSIAVNPGPFNQKEHMLVTMMATTAGSGPIS
SLLVWAQVLPQYFNQSYARSFGYIFLNTFATNFIGYGFAGLIRPFLVYPAFCIWPRSLVTIALNKALHTRDDESR
SVAGPFNTVWRISRYRLFLYAFGAMFVYFWFPNFIFQALSYFSWMTWIAPNNVMLNVLTGMKNGLGLFNPFSTLD
WNILNQNPLTVPAWSTFNNAAGMFIGGLCILAMWAANVWNTAYLPINTNRSFDHFGKPYNVSAILTPEGFLDNEK
YANYSASYISAGFIMYHVGYFAIYTAMITYVLLYHWHELKTGYKNVFARLLPNKWKRRDCEKPTSARSDSNDVHI
LPEWWYLLILAIAFVFGILAIVVYPTHTSPVAVVYGTLLSIVFIIPSGILASTTGISVYLVILGQFLGGLYGKGN
ALAMNFFQSYATVTASHALTFANDLKLGHYLKVPPRVTFAGQVVATLISSIIVTGMLKFQMTIKDVCTPNAPMRF
YCPWVTSWSTESVLWGTIGPEKVFGIHGQYSWLLMGFPIGMLLVIVVWALGKKWPDSHLLRNIHVPLLMTGASNW
GIYSFSYMFPAVPLAWFSWIYIRGRYPVFWQKYNFVLSAALSAGIAVAAIFMFFTVQWANVKINWWGNTVISKGC
EGTTPCLGKTLAKGERFYPWWDGTKVPAP*
Coding >OphauB2|2054
ATGAAGCCAGCGTCGAGCAACGATAGTTTATTACAGGCTGACGACTCGGGGGATGAACGGAACCGAGATGCGGAA
AAGAGCACGAGAATCGATGCTGATGCGAGACGACTTGATCCTTCAAAAGATGAGATTCTCGAGGCGGAGGAAGTG
GCGGCTTGCATGACGCTTGAGCGAGCCCAGCTTATTCTACAAGAAACTGTAAAGACACATAGCGGAGACCCCAAC
TTTCCTTTTTCAACACTCTGCACCATCAAGGAATATCTCTCCTGCAATGACATTGACGACGCCCTCGCCCACCGC
ATCAAACTCCAAGCCTCTCTTCTCTACAACAACAGCCCATACCCCGAAGTCCGCGGCGTCGTCGACAACCACGAC
GACCCCCTCCTTCCCGCTTCCACCCTCCGCGCCTGGACGCTCGGCATCTTTTTTTCCATGCTCGTTGCTGCCGTT
AACCAGCTCTTTAGTATCCGCCAGCCAGGTATCGGCATCGGCGGCACCATTGTCCAGCTGCTGGCTTTTCCCCTC
GGCAAGGCCTGGGAGCGCTGGATGCCGCGCCGCGAGTTGTGTATCCCGTTTACCAGGCATTCTATTGCGGTGAAT
CCCGGGCCGTTTAACCAAAAGGAACACATGCTCGTCACCATGATGGCGACTACGGCGGGCAGCGGGCCTATTTCG
AGTTTGCTGGTTTGGGCGCAGGTGCTGCCGCAGTACTTTAACCAGTCGTACGCGCGCAGCTTTGGCTACATCTTT
TTAAACACGTTTGCTACTAATTTTATTGGATACGGCTTTGCCGGGCTGATTCGTCCCTTTCTCGTCTATCCCGCC
TTTTGCATCTGGCCGCGCTCCCTCGTCACTATTGCGCTAAACAAGGCGCTGCATACAAGAGACGACGAGAGCCGC
TCCGTGGCTGGCCCTTTCAACACGGTCTGGCGCATCTCGCGCTACCGTCTCTTTCTCTATGCTTTTGGCGCCATG
TTTGTCTATTTTTGGTTTCCAAATTTCATCTTTCAGGCCCTCTCCTACTTTTCCTGGATGACGTGGATCGCCCCC
AATAATGTCATGCTCAACGTCTTGACGGGCATGAAGAATGGCCTGGGCTTGTTTAATCCCTTTTCCACACTCGAC
TGGAACATTTTGAACCAAAACCCCTTGACCGTGCCAGCCTGGTCAACGTTCAACAATGCGGCGGGAATGTTCATC
GGCGGCCTCTGCATCCTGGCCATGTGGGCAGCCAATGTCTGGAACACGGCCTACCTCCCCATCAACACGAACCGC
AGCTTTGACCACTTTGGCAAGCCGTACAACGTCTCTGCCATTTTAACCCCAGAGGGTTTCCTCGACAATGAAAAG
TATGCAAACTACTCGGCGTCGTATATTAGCGCCGGCTTCATCATGTACCATGTTGGCTATTTTGCCATTTATACC
GCCATGATTACCTATGTGCTGCTCTATCACTGGCACGAGTTGAAGACTGGCTATAAAAATGTCTTTGCGCGCCTC
CTCCCCAACAAATGGAAGCGACGAGACTGCGAAAAGCCCACCAGCGCCCGCAGCGATTCCAACGATGTTCATATT
CTCCCGGAATGGTGGTATTTATTGATCCTCGCCATTGCCTTTGTCTTTGGCATCTTGGCCATTGTCGTCTATCCG
ACACATACCTCGCCCGTCGCCGTCGTCTATGGCACGCTGCTCTCCATTGTCTTTATCATTCCCTCCGGCATCTTG
GCCTCGACGACTGGTATCAGCGTCTACCTTGTCATTCTGGGCCAGTTTCTCGGTGGGCTGTACGGCAAAGGCAAC
GCCCTCGCCATGAATTTCTTTCAGTCTTATGCAACCGTTACGGCGTCGCATGCACTCACCTTTGCCAATGACTTG
AAACTCGGTCATTACCTCAAGGTGCCTCCGCGCGTCACCTTTGCCGGCCAAGTCGTCGCCACCCTCATCTCATCC
ATCATTGTCACGGGCATGCTCAAGTTCCAGATGACCATTAAAGACGTTTGCACTCCAAACGCGCCCATGCGCTTC
TACTGCCCCTGGGTGACTTCGTGGTCGACCGAGTCGGTCCTCTGGGGCACCATTGGCCCTGAAAAGGTTTTTGGC
ATCCACGGCCAGTACTCGTGGCTGCTCATGGGCTTTCCCATTGGCATGCTTCTCGTTATTGTTGTTTGGGCGCTT
GGCAAAAAGTGGCCCGATTCGCACCTCTTGCGCAACATTCACGTTCCGCTCCTCATGACTGGCGCCAGCAACTGG
GGCATTTATAGCTTCTCATACATGTTCCCCGCCGTCCCCCTCGCCTGGTTCTCCTGGATCTACATTCGCGGCCGC
TATCCCGTCTTTTGGCAAAAGTACAACTTTGTCCTCTCGGCCGCCCTGTCCGCCGGCATTGCCGTTGCTGCCATC
TTTATGTTTTTTACCGTGCAGTGGGCCAACGTTAAAATCAATTGGTGGGGCAACACGGTTATTTCAAAGGGCTGC
GAGGGCACCACGCCTTGTCTCGGCAAGACGCTGGCCAAGGGCGAGCGCTTTTACCCCTGGTGGGATGGGACCAAG
GTTCCGGCGCCTTGA
Transcript >OphauB2|2054
ATGAAGCCAGCGTCGAGCAACGATAGTTTATTACAGGCTGACGACTCGGGGGATGAACGGAACCGAGATGCGGAA
AAGAGCACGAGAATCGATGCTGATGCGAGACGACTTGATCCTTCAAAAGATGAGATTCTCGAGGCGGAGGAAGTG
GCGGCTTGCATGACGCTTGAGCGAGCCCAGCTTATTCTACAAGAAACTGTAAAGACACATAGCGGAGACCCCAAC
TTTCCTTTTTCAACACTCTGCACCATCAAGGAATATCTCTCCTGCAATGACATTGACGACGCCCTCGCCCACCGC
ATCAAACTCCAAGCCTCTCTTCTCTACAACAACAGCCCATACCCCGAAGTCCGCGGCGTCGTCGACAACCACGAC
GACCCCCTCCTTCCCGCTTCCACCCTCCGCGCCTGGACGCTCGGCATCTTTTTTTCCATGCTCGTTGCTGCCGTT
AACCAGCTCTTTAGTATCCGCCAGCCAGGTATCGGCATCGGCGGCACCATTGTCCAGCTGCTGGCTTTTCCCCTC
GGCAAGGCCTGGGAGCGCTGGATGCCGCGCCGCGAGTTGTGTATCCCGTTTACCAGGCATTCTATTGCGGTGAAT
CCCGGGCCGTTTAACCAAAAGGAACACATGCTCGTCACCATGATGGCGACTACGGCGGGCAGCGGGCCTATTTCG
AGTTTGCTGGTTTGGGCGCAGGTGCTGCCGCAGTACTTTAACCAGTCGTACGCGCGCAGCTTTGGCTACATCTTT
TTAAACACGTTTGCTACTAATTTTATTGGATACGGCTTTGCCGGGCTGATTCGTCCCTTTCTCGTCTATCCCGCC
TTTTGCATCTGGCCGCGCTCCCTCGTCACTATTGCGCTAAACAAGGCGCTGCATACAAGAGACGACGAGAGCCGC
TCCGTGGCTGGCCCTTTCAACACGGTCTGGCGCATCTCGCGCTACCGTCTCTTTCTCTATGCTTTTGGCGCCATG
TTTGTCTATTTTTGGTTTCCAAATTTCATCTTTCAGGCCCTCTCCTACTTTTCCTGGATGACGTGGATCGCCCCC
AATAATGTCATGCTCAACGTCTTGACGGGCATGAAGAATGGCCTGGGCTTGTTTAATCCCTTTTCCACACTCGAC
TGGAACATTTTGAACCAAAACCCCTTGACCGTGCCAGCCTGGTCAACGTTCAACAATGCGGCGGGAATGTTCATC
GGCGGCCTCTGCATCCTGGCCATGTGGGCAGCCAATGTCTGGAACACGGCCTACCTCCCCATCAACACGAACCGC
AGCTTTGACCACTTTGGCAAGCCGTACAACGTCTCTGCCATTTTAACCCCAGAGGGTTTCCTCGACAATGAAAAG
TATGCAAACTACTCGGCGTCGTATATTAGCGCCGGCTTCATCATGTACCATGTTGGCTATTTTGCCATTTATACC
GCCATGATTACCTATGTGCTGCTCTATCACTGGCACGAGTTGAAGACTGGCTATAAAAATGTCTTTGCGCGCCTC
CTCCCCAACAAATGGAAGCGACGAGACTGCGAAAAGCCCACCAGCGCCCGCAGCGATTCCAACGATGTTCATATT
CTCCCGGAATGGTGGTATTTATTGATCCTCGCCATTGCCTTTGTCTTTGGCATCTTGGCCATTGTCGTCTATCCG
ACACATACCTCGCCCGTCGCCGTCGTCTATGGCACGCTGCTCTCCATTGTCTTTATCATTCCCTCCGGCATCTTG
GCCTCGACGACTGGTATCAGCGTCTACCTTGTCATTCTGGGCCAGTTTCTCGGTGGGCTGTACGGCAAAGGCAAC
GCCCTCGCCATGAATTTCTTTCAGTCTTATGCAACCGTTACGGCGTCGCATGCACTCACCTTTGCCAATGACTTG
AAACTCGGTCATTACCTCAAGGTGCCTCCGCGCGTCACCTTTGCCGGCCAAGTCGTCGCCACCCTCATCTCATCC
ATCATTGTCACGGGCATGCTCAAGTTCCAGATGACCATTAAAGACGTTTGCACTCCAAACGCGCCCATGCGCTTC
TACTGCCCCTGGGTGACTTCGTGGTCGACCGAGTCGGTCCTCTGGGGCACCATTGGCCCTGAAAAGGTTTTTGGC
ATCCACGGCCAGTACTCGTGGCTGCTCATGGGCTTTCCCATTGGCATGCTTCTCGTTATTGTTGTTTGGGCGCTT
GGCAAAAAGTGGCCCGATTCGCACCTCTTGCGCAACATTCACGTTCCGCTCCTCATGACTGGCGCCAGCAACTGG
GGCATTTATAGCTTCTCATACATGTTCCCCGCCGTCCCCCTCGCCTGGTTCTCCTGGATCTACATTCGCGGCCGC
TATCCCGTCTTTTGGCAAAAGTACAACTTTGTCCTCTCGGCCGCCCTGTCCGCCGGCATTGCCGTTGCTGCCATC
TTTATGTTTTTTACCGTGCAGTGGGCCAACGTTAAAATCAATTGGTGGGGCAACACGGTTATTTCAAAGGGCTGC
GAGGGCACCACGCCTTGTCTCGGCAAGACGCTGGCCAAGGGCGAGCGCTTTTACCCCTGGTGGGATGGGACCAAG
GTTCCGGCGCCTTGA
Gene >OphauB2|2054
ATGAAGCCAGCGTCGAGCAACGATAGTTTATTACAGGCTGACGACTCGGGGGATGAACGGGTATGTGCAAGCAAG
GATATGAGATGGTTCAAGACTAAGCAGCAAGCAGAACCGAGATGCGGAAAAGAGCACGAGAATCGATGCTGATGC
GAGGCAAGGCTTTGTTTCTCAAAAATGAAATTGCTGGGAAACTAACCTTTTTTATTAGACGACTTGATCCTTCAA
AAGATGAGATTCTCGAGGCGGAGGAAGTGGCGGCTTGCATGACGCTTGAGCGAGCCCAGCTTGCAAGTCGACAAA
CCAACTCTTGGGAAAACTAGTCTTCTAACCCGCGCATAGATTCTACAAGAAACTGTAAAGACACATAGCGGAGAC
CCCAACTTTCCTTTTTCAACACTCTGCACCATCAAGGAATATCTCTGTACGCGCTCCTTCTTTACCCGCCTTTCC
CCTTTTTTCCGCTAATTCCCCCTCAGCCTGCAATGACATTGACGACGCCCTCGCCCACCGCATCAAACTCCAAGC
CTCTCTTCTCTACAACAACAGCCCATACCCCGAAGTCCGCGGCGTCGTCGACAACCACGACGACCCCCTCCTTCC
CGCTTCCACCCTCCGCGCCTGGACGCTCGGCATCTTTTTTTCCATGCTCGTTGCTGCCGTTAACCAGCTCTTTAG
TATCCGCCAGCCAGGTATCGGCATCGGCGGCACCATTGTCCAGCTGCTGGCTTTTCCCCTCGGCAAGGCCTGGGA
GCGCTGGATGCCGCGCCGCGAGTTGTGTATCCCGTTTACCAGGCATTCTATTGCGGTGAATCCCGGGCCGTTTAA
CCAAAAGGAACACATGCTCGTCACCATGATGGCGACTACGGCGGGCAGCGGGCCTATTTCGAGTTTGCTGGTTTG
GGCGCAGGTGCTGCCGCAGTACTTTAACCAGTCGTACGCGCGCAGCTTTGGCTACATCTTTTTAAACACGTTTGC
TACTAATTTTATTGGATACGGCTTTGCCGGGCTGATTCGTCCCTTTCTCGTCTATCCCGCCTTTTGCATCTGGCC
GCGCTCCCTCGTCACTATTGCGCTAAACAAGGCGCTGCATACAAGAGACGACGAGAGCCGCTCCGTGGCTGGCCC
TTTCAACACGGTCTGGCGCATCTCGCGCTACCGTCTCTTTCTCTATGCTTTTGGCGCCATGTTTGTCTATTTTTG
GTTTCCAAATTTCATCTTTCAGGCCCTCTCCTACTTTTCCTGGATGACGTGGATCGCCCCCAATAATGTCATGCT
CAACGTCTTGACGGGCATGAAGAATGGCCTGGGCGTGAGTCTTGCGGACCGCTTATATCCCCCAAAAAAAAACTT
GAGCAAGCGGGTGCTAACGTTGGGGGCGTCTAGTTGTTTAATCCCTTTTCCACACTCGACTGGAACATTTTGAAC
CAAAACCCCTTGGTACGCTTTTTACCCCCCTTCTTGCTCGCCGCCAAGCTCTCAAGCTAACGCCTCCACCCATTT
ATAGACCGTGCCAGCCTGGTCAACGTTCAACAATGCGGCGGGAATGTTCATCGGCGGCCTCTGCATCCTGGCCAT
GTGGGCAGCCAATGTCTGGAACACGGCCTACCTCCCCATCAACACGAACCGCAGCTTTGACCACTTTGGCAAGCC
GTACAACGTCTCTGCCATTTTAACCCCAGAGGGTTTCCTCGACAATGAAAAGTATGCAAACTACTCGGCGTCGTA
TATTAGCGCCGGCTTCATCATGTACCATGTTGGCTATTTTGCCATTTATACCGCCATGATTACCTATGTGCTGCT
CTATCACTGGCACGAGTTGAAGACTGGCTATAAAAATGTCTTTGCGCGCCTCCTCCCCAACAAATGGAAGCGACG
AGACTGCGAAAAGCCCACCAGCGCCCGCAGCGATTCCAACGATGTTCATATTCGTCTCATGGCAGCGTATACAGA
AGGCATGTCCATCAACACACACACCCACTATACCCAATTCCCCTCTTTTCCTACGTAAGCTAACAATTCAACTCC
TAGTCCCGGAATGGTGGTATTTATTGATCCTCGCCATTGCCTTTGTCTTTGGCATCTTGGCCATTGTCGTCTATC
CGACACATACCTCGCCCGTCGCCGTCGTCTATGGCACGCTGCTCTCCATTGTCTTTATCATTCCCTCCGGCATCT
TGGCCTCGACGACTGGTATCAGCGTCTACCTTGTCATTCTGGGCCAGTTTCTCGGTGGGCTGTACGGCAAAGGCA
ACGCCCTCGCCATGAATTTCTTTCAGTCTTATGCGTAAGTCGTTGGCCTGTAAAACCCAGCCATGATGAAAAAAA
AAAAAGAATTAACCAAGTCGTCAACAGAACCGTTACGGCGTCGCATGCACTCACCTTTGCCAATGACTTGAAACT
CGGTCATTACCTCAAGGTAAGAATTCTCTCTACATCTACGGCTTGGAAAACTGCTGAGACTAACACTGGGATAGG
TGCCTCCGCGCGTCACCTTTGCCGGCCAAGTCGTCGCCACCCTCATCTCATCCATCATTGTCACGGGCATGCTCA
AGTTCCAGGTACCTTTTTTCCCCATCGTCTTTTCCCCCCAAAGCATGCTCGTCTTTTTTTAACACTGCCGACAGA
TGACCATTAAAGACGTTTGCACTCCAAACGCGCCCATGCGCTTCTACTGCCCCTGGGTGACTTCGTGGTCGACCG
AGTCGGTCCTCTGGGGCACCATTGGCCCTGAAAAGGTTTTTGGCATCCACGGCCAGTACTCGTGGCTGCTCATGG
GCTTTCCCATTGGCATGCTTCTCGTTATTGTTGTTTGGGCGCTTGGCAAAAAGTGGCCCGATTCGCACCTCTTGC
GCAACATTCACGTTCCGCTCCTCATGACTGGCGCCAGCAACTGGGGCATTTATAGTGCGTATTTGCTCCTTTTTC
CCCCACCTCTTTAACCTATACCCGTCTCTCCTCACCTCTTTAACCTATATCCCTCTCTTCCTCACCTCTTTACTA
TATCCGTCTCTCCTCACCTCTTTAACCTATATCCGTCTCTTCCTCACCTCTACAGCCAATACCCCCTTCTAACAT
TAAATCTCCAGGCTTCTCATACATGTTCCCCGCCGTCCCCCTCGCCTGGTTCTCCTGGATCTACATTCGCGGCCG
CTATCCCGTCTTTTGGCAAAAGTACAACTTTGTCCTCTCGGCCGCCCTGTCCGCCGGCATTGCCGTTGCTGCCAT
CTTTATGTTTTTTACCGTGCAGTGGGCCAACGTTAAAATCAATTGGTGGGGCAACACGGTTATTTCAAAGGGCTG
CGAGGGCACCACGCCTTGTCTCGGCAAGACGCTGGCCAAGGGCGAGCGCTTTTACCCCTGGTGGGATGGGACCAA
GGTTCCGGCGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail