Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2045
Gene name
LocationContig_16:238669..241718
Strand+
Gene length (bp)3049
Transcript length (bp)2997
Coding sequence length (bp)2997
Protein length (aa) 999

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02171 Piwi Piwi domain 6.0E-81 619 926
PF16486 ArgoN N-terminal domain of argonaute 4.7E-20 93 234
PF16488 ArgoL2 Argonaute linker 2 domain 2.9E-10 471 515
PF08699 ArgoL1 Argonaute linker 1 domain 5.1E-10 245 301
PF02170 PAZ PAZ domain 4.3E-10 353 460

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ago1 PE=1 SV=1 92 931 2.0E-121
sp|Q9SJK3|AGO5_ARATH Protein argonaute 5 OS=Arabidopsis thaliana GN=AGO5 PE=1 SV=2 90 924 5.0E-99
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 14 924 2.0E-98
sp|O04379|AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana GN=AGO1 PE=1 SV=1 44 962 3.0E-96
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 12 924 8.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ago1 PE=1 SV=1 92 931 2.0E-121
sp|Q9SJK3|AGO5_ARATH Protein argonaute 5 OS=Arabidopsis thaliana GN=AGO5 PE=1 SV=2 90 924 5.0E-99
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 14 924 2.0E-98
sp|O04379|AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana GN=AGO1 PE=1 SV=1 44 962 3.0E-96
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 12 924 8.0E-96
sp|Q7Y001|AGO12_ORYSJ Protein argonaute 12 OS=Oryza sativa subsp. japonica GN=AGO12 PE=2 SV=2 88 924 2.0E-94
sp|Q851R2|MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica GN=MEL1 PE=2 SV=1 92 947 2.0E-91
sp|Q6K972|AGO1C_ORYSJ Protein argonaute 1C OS=Oryza sativa subsp. japonica GN=AGO1C PE=2 SV=1 73 924 8.0E-91
sp|Q9QZ81|AGO2_RAT Protein argonaute-2 OS=Rattus norvegicus GN=Ago2 PE=2 SV=2 90 926 5.0E-89
sp|Q8CJG0|AGO2_MOUSE Protein argonaute-2 OS=Mus musculus GN=Ago2 PE=1 SV=3 90 926 6.0E-89
sp|Q9UKV8|AGO2_HUMAN Protein argonaute-2 OS=Homo sapiens GN=AGO2 PE=1 SV=3 90 926 7.0E-89
sp|Q6DCX2|AGO2_XENLA Protein argonaute-2 OS=Xenopus laevis GN=ago2 PE=2 SV=1 90 955 7.0E-89
sp|Q9XGW1|AGO10_ARATH Protein argonaute 10 OS=Arabidopsis thaliana GN=AGO10 PE=2 SV=1 110 924 1.0E-87
sp|O77503|AGO2_RABIT Protein argonaute-2 (Fragment) OS=Oryctolagus cuniculus GN=AGO2 PE=1 SV=2 90 926 2.0E-87
sp|Q6QME8|AGO2_BOVIN Protein argonaute-2 OS=Bos taurus GN=AGO2 PE=2 SV=1 90 926 5.0E-87
sp|Q5Z5B2|AGO1D_ORYSJ Protein argonaute 1D OS=Oryza sativa subsp. japonica GN=AGO1D PE=2 SV=1 111 924 8.0E-87
sp|Q6DJB9|AGO2_XENTR Protein argonaute-2 OS=Xenopus tropicalis GN=ago2 PE=2 SV=1 90 955 3.0E-85
sp|Q69VD5|PNH1_ORYSJ Protein argonaute PNH1 OS=Oryza sativa subsp. japonica GN=PHN1 PE=2 SV=1 111 924 1.0E-84
sp|A3KPK0|AGO3_DANRE Protein argonaute-3 OS=Danio rerio GN=ago3 PE=3 SV=1 90 926 3.0E-84
sp|Q75HC2|AGO7_ORYSJ Protein argonaute 7 OS=Oryza sativa subsp. japonica GN=AGO7 PE=2 SV=2 81 936 8.0E-84
sp|Q8CJF9|AGO3_MOUSE Protein argonaute-3 OS=Mus musculus GN=Ago3 PE=2 SV=2 90 926 1.0E-82
sp|Q9H9G7|AGO3_HUMAN Protein argonaute-3 OS=Homo sapiens GN=AGO3 PE=1 SV=2 90 926 2.0E-82
sp|Q8CJG1|AGO1_MOUSE Protein argonaute-1 OS=Mus musculus GN=Ago1 PE=1 SV=2 72 926 3.0E-82
sp|Q9UL18|AGO1_HUMAN Protein argonaute-1 OS=Homo sapiens GN=AGO1 PE=1 SV=3 72 926 3.0E-82
sp|Q5ZLG4|AGO3_CHICK Protein argonaute-3 OS=Gallus gallus GN=AGO3 PE=2 SV=1 90 926 2.0E-81
sp|Q4KLV6|AGO4_XENLA Protein argonaute-4 OS=Xenopus laevis GN=ago4 PE=2 SV=1 84 926 5.0E-80
sp|Q6T5B7|AGO3_BOVIN Protein argonaute-3 OS=Bos taurus GN=AGO3 PE=2 SV=2 90 926 6.0E-79
sp|Q9HCK5|AGO4_HUMAN Protein argonaute-4 OS=Homo sapiens GN=AGO4 PE=1 SV=2 84 926 6.0E-78
sp|Q9C793|AGO7_ARATH Protein argonaute 7 OS=Arabidopsis thaliana GN=AGO7 PE=2 SV=1 91 926 7.0E-78
sp|Q0JF58|AGO4B_ORYSJ Protein argonaute 4B OS=Oryza sativa subsp. japonica GN=AGO4B PE=2 SV=1 80 923 6.0E-77
sp|Q6Z4F1|AGO14_ORYSJ Protein argonaute 14 OS=Oryza sativa subsp. japonica GN=AGO14 PE=2 SV=1 90 941 9.0E-77
sp|Q5ZMW0|AGO4_CHICK Protein argonaute-4 OS=Gallus gallus GN=AGO4 PE=2 SV=1 154 926 1.0E-76
sp|Q8CJF8|AGO4_MOUSE Protein argonaute-4 OS=Mus musculus GN=Ago4 PE=2 SV=2 84 926 1.0E-76
sp|Q84VQ0|AGO9_ARATH Protein argonaute 9 OS=Arabidopsis thaliana GN=AGO9 PE=1 SV=2 90 922 1.0E-76
sp|Q6YSJ5|AGO16_ORYSJ Protein argonaute 16 OS=Oryza sativa subsp. japonica GN=AGO16 PE=2 SV=2 91 922 3.0E-76
sp|Q10F39|AGO11_ORYSJ Protein argonaute 11 OS=Oryza sativa subsp. japonica GN=AGO11 PE=2 SV=2 344 924 2.0E-73
sp|P34681|TAG76_CAEEL Putative protein tag-76 OS=Caenorhabditis elegans GN=tag-76 PE=3 SV=2 361 934 2.0E-73
sp|Q9ZVD5|AGO4_ARATH Protein argonaute 4 OS=Arabidopsis thaliana GN=AGO4 PE=1 SV=2 90 922 4.0E-73
sp|Q69UP6|AGO18_ORYSJ Protein argonaute 18 OS=Oryza sativa subsp. japonica GN=AGO18 PE=2 SV=1 114 924 1.0E-72
sp|Q9SHF3|AGO2_ARATH Protein argonaute 2 OS=Arabidopsis thaliana GN=AGO2 PE=1 SV=1 95 931 8.0E-71
sp|Q9SDG8|AGO4A_ORYSJ Protein argonaute 4A OS=Oryza sativa subsp. japonica GN=AGO4A PE=2 SV=1 91 923 1.0E-70
sp|Q7XTS3|AGO3_ORYSJ Protein argonaute 3 OS=Oryza sativa subsp. japonica GN=AGO3 PE=2 SV=2 348 926 7.0E-70
sp|Q852N2|AGO13_ORYSJ Protein argonaute 13 OS=Oryza sativa subsp. japonica GN=AGO13 PE=2 SV=1 266 946 1.0E-68
sp|Q7XTS4|AGO2_ORYSJ Protein argonaute 2 OS=Oryza sativa subsp. japonica GN=AGO2 PE=2 SV=2 224 926 7.0E-68
sp|Q9SHF2|AGO3_ARATH Protein argonaute 3 OS=Arabidopsis thaliana GN=AGO3 PE=3 SV=1 95 930 1.0E-66
sp|O48771|AGO6_ARATH Protein argonaute 6 OS=Arabidopsis thaliana GN=AGO6 PE=2 SV=2 88 923 5.0E-66
sp|Q6H6C3|AGO17_ORYSJ Protein argonaute 17 OS=Oryza sativa subsp. japonica GN=AGO17 PE=2 SV=1 92 926 8.0E-61
sp|Q5NBN9|AGO15_ORYSJ Protein argonaute 15 OS=Oryza sativa subsp. japonica GN=AGO15 PE=2 SV=2 344 923 1.0E-58
sp|Q9VUQ5|AGO2_DROME Protein argonaute-2 OS=Drosophila melanogaster GN=AGO2 PE=1 SV=3 387 926 2.0E-57
sp|Q3E984|AGO8_ARATH Protein argonaute 8 OS=Arabidopsis thaliana GN=AGO8 PE=3 SV=1 90 922 2.0E-57
sp|O61931|ERGO1_CAEEL Piwi-like protein ergo-1 OS=Caenorhabditis elegans GN=ergo-1 PE=1 SV=2 390 924 5.0E-33
sp|Q9JMB7|PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus GN=Piwil1 PE=1 SV=1 371 917 5.0E-28
sp|Q96J94|PIWL1_HUMAN Piwi-like protein 1 OS=Homo sapiens GN=PIWIL1 PE=1 SV=1 371 917 6.0E-28
sp|O76922|AUB_DROME Protein aubergine OS=Drosophila melanogaster GN=aub PE=1 SV=1 490 917 3.0E-27
sp|Q09249|YQ53_CAEEL Uncharacterized protein C16C10.3 OS=Caenorhabditis elegans GN=C16C10.3 PE=3 SV=1 392 924 4.0E-26
sp|Q8CGT6|PIWL4_MOUSE Piwi-like protein 4 OS=Mus musculus GN=Piwil4 PE=1 SV=3 401 917 5.0E-26
sp|Q9VKM1|PIWI_DROME Protein piwi OS=Drosophila melanogaster GN=piwi PE=1 SV=1 371 900 2.0E-24
sp|Q8UVX0|PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 SV=1 451 917 5.0E-24
sp|Q7Z3Z3|PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens GN=PIWIL3 PE=2 SV=2 401 917 1.0E-23
sp|Q21770|WAGO1_CAEEL Argonaute protein wago-1 OS=Caenorhabditis elegans GN=wago-1 PE=1 SV=1 401 924 2.0E-23
sp|Q4G033|PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus GN=Piwil4 PE=2 SV=2 401 917 2.0E-23
sp|Q7PLK0|AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster GN=AGO3 PE=1 SV=3 617 917 2.0E-23
sp|A6N7Y9|PIWL1_CHICK Piwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=2 SV=1 401 917 3.0E-22
sp|A8KBF3|PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis GN=piwil2 PE=1 SV=1 594 917 6.0E-21
sp|A2CEI6|PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio GN=piwil2 PE=1 SV=2 490 917 8.0E-21
sp|Q7Z3Z4|PIWL4_HUMAN Piwi-like protein 4 OS=Homo sapiens GN=PIWIL4 PE=2 SV=2 401 917 2.0E-19
sp|Q8CDG1|PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus GN=Piwil2 PE=1 SV=2 490 917 3.0E-19
sp|Q8TC59|PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens GN=PIWIL2 PE=1 SV=1 490 917 4.0E-19
sp|Q2Q5Y8|PIWI2_SCHMD Piwi-like protein 2 OS=Schmidtea mediterranea GN=wi-2 PE=2 SV=1 643 949 3.0E-18
sp|Q2Q5Y9|PIWI1_SCHMD Piwi-like protein 1 OS=Schmidtea mediterranea GN=wi-1 PE=2 SV=1 696 930 4.0E-17
sp|A6P7L8|PIWL2_ONCMY Piwi-like protein 2 OS=Oncorhynchus mykiss GN=piwil2 PE=2 SV=1 490 917 4.0E-17
sp|Q21691|NRDE3_CAEEL Nuclear RNAi defective-3 protein OS=Caenorhabditis elegans GN=nrde-3 PE=1 SV=1 391 955 3.0E-16
sp|Q2PC95|PIWIL_DUGJA Piwi-like protein OS=Dugesia japonica GN=iwi PE=2 SV=1 636 949 6.0E-15
sp|Q86QW7|AGO_GIAIN Protein argonaute OS=Giardia intestinalis GN=Ago PE=1 SV=2 642 917 3.0E-09
sp|A8BCK6|AGO_GIAIC Protein argonaute OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=Ago PE=3 SV=1 642 917 4.0E-09
sp|C6LTG5|AGO_GIAIB Protein argonaute OS=Giardia intestinalis (strain ATCC 50581 / GS clone H7) GN=Ago PE=3 SV=1 643 918 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2045
MSDRGRSPAASGGPAGASRAAQMSMSRDNSSASSQAKDPSKSWSPGMGFDPAKPAAKADKGNTRMELPPDAFVPD
TQKSRFALRNNKMNTEGKPIPIEVNQYRMKSFDSSKKIYQYDVLISPDTEKKAVVLKKIWQHPTTKKFLEKYSFP
KWIFDGRKLAWAPALLDRGEIRFAVDLDEGKRPPNAPAREGNKFLIMIRKTTTIDVSVLRGYLDNKVSFSTAVQE
ALNFLDHLLRQWPSQRMLCIKRNFYNEQGSGIALNPAPSYVEVHKGLYASIRLSHNLKNGGIGLALNADVVNTCF
WAAPWTVAQMVGPYLHGCDSRRWHGLLPENMSREFRPVKQGDQWGSSDAFKHLRKLRRLRFKVQHPNRANSDTVY
SIQDFVFDQGYGSEGATAATVSFDCNGKKMTIRDYYMSRYKAHLMYPNLPVIDAGKGRYFPFEFAYLEPLQRYPF
KLNPEQTAAMIKLAVTRPAVRRSDIQKGVDSLQLQQDPFLKEYGVQFEPGFTRTEARLLPPPKVEFGQGSGVVEP
KFSGRWDLRGKKFFKQNAAPMASWGFIAMNNCVDYPSLQNFAKSFRQSFLAHGGNCSQEAMLMNVPPNFRDNIAG
AMAWAVEEMTRQRGYPQLLFVVVAHRNSPHYERLKKSGDCRFGILTQVVNNDSVRKNHGQYLSNVCLKVNAKLGG
ATSRTPPPWKSTPHYFPADRPTMIIGVDISHPPPGGTSPSTAAMTMSLDRDATRYGAMVESNGYRKEMLEAVNVH
TFMNHLSNLWRSAHGGGAFPRHIIYFRDGVSEGQFAHVLDQEIGQIRAWFDENAKGKPMPKFTVVIATKRHHIRF
FPPSNSRDADRNGNPLPGTLVEREVTHPFMWDFYLNSHAAIQGTARPVHYHIILDEMGVPANDFQKMIYHQCYTY
ARSTTPVSLHPAVYYAHLAGARARCHENVSAGLGYRHGGKGHEVIQERIARGVTMGGPSDDGVPRALLTLGGEVD
GEKGAVEGEQRQRNFFRSTMWYM*
Coding >OphauB2|2045
ATGTCCGACAGAGGTCGTTCTCCCGCGGCCTCGGGCGGGCCCGCTGGGGCGTCGCGGGCCGCTCAAATGTCAATG
AGCCGTGATAATTCTTCCGCAAGCTCGCAAGCCAAGGATCCTTCCAAAAGCTGGTCTCCTGGCATGGGATTCGAT
CCGGCAAAGCCTGCCGCCAAGGCTGACAAAGGCAACACGCGCATGGAATTGCCTCCGGACGCATTCGTACCTGAC
ACGCAGAAGAGTCGCTTTGCTCTACGCAACAACAAGATGAACACAGAGGGAAAGCCAATTCCCATTGAAGTGAAT
CAATATCGTATGAAGAGCTTCGACTCTTCCAAGAAGATCTACCAATACGATGTCCTTATATCTCCCGACACTGAG
AAGAAGGCTGTTGTGTTGAAGAAGATTTGGCAGCACCCAACTACCAAGAAGTTTCTTGAAAAGTACAGTTTCCCC
AAGTGGATTTTTGATGGACGCAAGCTGGCTTGGGCGCCCGCCCTGCTCGATCGTGGCGAAATTCGTTTCGCCGTC
GATCTTGATGAGGGCAAACGTCCACCTAATGCTCCAGCCCGAGAGGGCAACAAGTTTCTTATCATGATCAGAAAG
ACCACGACCATTGATGTCTCGGTGCTGCGTGGATATCTTGATAACAAGGTTTCTTTCAGCACGGCTGTCCAAGAG
GCGCTCAATTTTCTCGACCACTTGCTGCGTCAATGGCCCTCTCAGCGCATGCTTTGCATCAAGCGCAACTTTTAC
AATGAGCAAGGCTCGGGTATAGCCCTAAATCCGGCTCCCAGCTACGTTGAAGTTCACAAGGGCCTGTATGCGTCT
ATTCGGCTTAGTCACAATCTCAAGAACGGCGGTATTGGCTTGGCACTGAATGCCGATGTCGTCAACACATGCTTC
TGGGCAGCCCCATGGACTGTTGCCCAGATGGTTGGCCCATATCTCCATGGATGCGATTCGCGTCGCTGGCACGGA
CTGCTTCCAGAGAATATGTCGCGAGAATTTCGTCCTGTTAAACAAGGGGACCAATGGGGCTCCTCGGACGCATTT
AAGCATCTGCGCAAGCTTCGCCGTTTGAGGTTCAAGGTGCAGCATCCGAACCGCGCCAACTCGGACACTGTTTAC
TCGATTCAGGACTTTGTCTTCGACCAAGGATACGGGTCAGAGGGCGCCACGGCTGCAACTGTTTCGTTTGATTGT
AATGGTAAGAAGATGACCATTCGCGACTACTACATGAGTCGCTACAAGGCCCATTTGATGTACCCAAATCTGCCG
GTCATCGACGCCGGAAAAGGCCGTTACTTCCCCTTCGAATTCGCATACCTGGAGCCTCTCCAGAGGTACCCCTTC
AAGCTCAATCCCGAGCAGACGGCTGCCATGATCAAGCTGGCGGTGACTCGCCCCGCAGTCAGACGCTCAGACATT
CAGAAGGGTGTAGACTCTTTGCAGCTACAGCAAGACCCATTCCTCAAGGAGTATGGGGTTCAATTCGAACCAGGC
TTTACAAGGACGGAGGCGCGTCTGTTGCCACCTCCGAAGGTTGAGTTTGGCCAGGGCAGTGGCGTGGTCGAGCCC
AAGTTCTCGGGTCGTTGGGACTTGCGAGGCAAGAAGTTTTTCAAGCAGAATGCGGCACCCATGGCCAGCTGGGGG
TTCATCGCGATGAACAACTGCGTGGACTATCCAAGCCTTCAGAATTTCGCCAAGTCCTTTCGCCAGTCCTTTTTG
GCACATGGCGGCAACTGTTCACAAGAGGCAATGCTCATGAATGTTCCGCCCAACTTCAGAGACAATATCGCAGGC
GCAATGGCCTGGGCCGTCGAAGAAATGACCAGGCAACGGGGATATCCTCAGCTTCTCTTCGTTGTTGTTGCGCAT
CGCAACAGTCCCCATTATGAACGTCTCAAGAAAAGCGGCGATTGTCGATTTGGCATACTGACCCAAGTAGTCAAT
AATGACTCAGTGCGAAAGAATCATGGGCAGTACCTGTCAAATGTTTGTCTAAAGGTCAACGCAAAACTAGGCGGT
GCAACGTCGCGCACGCCACCTCCATGGAAGTCGACTCCGCATTACTTTCCGGCGGATCGGCCAACCATGATCATT
GGTGTCGACATCTCGCACCCGCCTCCAGGTGGCACATCACCGTCAACTGCGGCCATGACTATGTCTTTGGATCGT
GATGCTACACGATATGGTGCCATGGTCGAGTCAAACGGCTACCGTAAGGAGATGCTGGAGGCCGTCAATGTGCAC
ACCTTCATGAATCATTTGAGCAATCTCTGGCGCAGTGCACATGGTGGTGGCGCCTTTCCTCGACACATCATCTAC
TTCAGAGATGGCGTTTCGGAGGGACAGTTTGCCCATGTCTTGGACCAGGAAATTGGCCAGATTCGCGCGTGGTTT
GACGAGAATGCCAAGGGCAAGCCGATGCCAAAGTTCACGGTTGTGATTGCAACCAAGCGACATCATATCCGCTTT
TTCCCGCCCAGCAACAGCCGAGATGCTGATCGTAATGGCAATCCTCTGCCAGGAACGTTGGTGGAGCGTGAAGTT
ACACATCCGTTTATGTGGGACTTCTACCTGAATTCTCACGCGGCTATTCAGGGTACTGCCAGGCCCGTGCATTAC
CACATTATTCTGGACGAGATGGGAGTGCCAGCAAATGACTTTCAGAAAATGATCTACCATCAGTGCTATACTTAT
GCACGCTCGACTACTCCGGTGTCGTTGCATCCGGCAGTTTATTACGCGCATTTGGCTGGCGCGCGGGCTCGCTGC
CATGAGAATGTTTCTGCGGGCCTCGGGTATCGACACGGTGGCAAGGGCCACGAGGTGATCCAGGAAAGGATTGCT
CGGGGAGTGACAATGGGAGGCCCTTCGGATGATGGCGTCCCACGCGCTCTGTTGACTTTGGGTGGAGAAGTGGAT
GGTGAGAAGGGCGCAGTTGAAGGGGAGCAGCGTCAGCGAAACTTCTTTCGAAGCACTATGTGGTACATGTAG
Transcript >OphauB2|2045
ATGTCCGACAGAGGTCGTTCTCCCGCGGCCTCGGGCGGGCCCGCTGGGGCGTCGCGGGCCGCTCAAATGTCAATG
AGCCGTGATAATTCTTCCGCAAGCTCGCAAGCCAAGGATCCTTCCAAAAGCTGGTCTCCTGGCATGGGATTCGAT
CCGGCAAAGCCTGCCGCCAAGGCTGACAAAGGCAACACGCGCATGGAATTGCCTCCGGACGCATTCGTACCTGAC
ACGCAGAAGAGTCGCTTTGCTCTACGCAACAACAAGATGAACACAGAGGGAAAGCCAATTCCCATTGAAGTGAAT
CAATATCGTATGAAGAGCTTCGACTCTTCCAAGAAGATCTACCAATACGATGTCCTTATATCTCCCGACACTGAG
AAGAAGGCTGTTGTGTTGAAGAAGATTTGGCAGCACCCAACTACCAAGAAGTTTCTTGAAAAGTACAGTTTCCCC
AAGTGGATTTTTGATGGACGCAAGCTGGCTTGGGCGCCCGCCCTGCTCGATCGTGGCGAAATTCGTTTCGCCGTC
GATCTTGATGAGGGCAAACGTCCACCTAATGCTCCAGCCCGAGAGGGCAACAAGTTTCTTATCATGATCAGAAAG
ACCACGACCATTGATGTCTCGGTGCTGCGTGGATATCTTGATAACAAGGTTTCTTTCAGCACGGCTGTCCAAGAG
GCGCTCAATTTTCTCGACCACTTGCTGCGTCAATGGCCCTCTCAGCGCATGCTTTGCATCAAGCGCAACTTTTAC
AATGAGCAAGGCTCGGGTATAGCCCTAAATCCGGCTCCCAGCTACGTTGAAGTTCACAAGGGCCTGTATGCGTCT
ATTCGGCTTAGTCACAATCTCAAGAACGGCGGTATTGGCTTGGCACTGAATGCCGATGTCGTCAACACATGCTTC
TGGGCAGCCCCATGGACTGTTGCCCAGATGGTTGGCCCATATCTCCATGGATGCGATTCGCGTCGCTGGCACGGA
CTGCTTCCAGAGAATATGTCGCGAGAATTTCGTCCTGTTAAACAAGGGGACCAATGGGGCTCCTCGGACGCATTT
AAGCATCTGCGCAAGCTTCGCCGTTTGAGGTTCAAGGTGCAGCATCCGAACCGCGCCAACTCGGACACTGTTTAC
TCGATTCAGGACTTTGTCTTCGACCAAGGATACGGGTCAGAGGGCGCCACGGCTGCAACTGTTTCGTTTGATTGT
AATGGTAAGAAGATGACCATTCGCGACTACTACATGAGTCGCTACAAGGCCCATTTGATGTACCCAAATCTGCCG
GTCATCGACGCCGGAAAAGGCCGTTACTTCCCCTTCGAATTCGCATACCTGGAGCCTCTCCAGAGGTACCCCTTC
AAGCTCAATCCCGAGCAGACGGCTGCCATGATCAAGCTGGCGGTGACTCGCCCCGCAGTCAGACGCTCAGACATT
CAGAAGGGTGTAGACTCTTTGCAGCTACAGCAAGACCCATTCCTCAAGGAGTATGGGGTTCAATTCGAACCAGGC
TTTACAAGGACGGAGGCGCGTCTGTTGCCACCTCCGAAGGTTGAGTTTGGCCAGGGCAGTGGCGTGGTCGAGCCC
AAGTTCTCGGGTCGTTGGGACTTGCGAGGCAAGAAGTTTTTCAAGCAGAATGCGGCACCCATGGCCAGCTGGGGG
TTCATCGCGATGAACAACTGCGTGGACTATCCAAGCCTTCAGAATTTCGCCAAGTCCTTTCGCCAGTCCTTTTTG
GCACATGGCGGCAACTGTTCACAAGAGGCAATGCTCATGAATGTTCCGCCCAACTTCAGAGACAATATCGCAGGC
GCAATGGCCTGGGCCGTCGAAGAAATGACCAGGCAACGGGGATATCCTCAGCTTCTCTTCGTTGTTGTTGCGCAT
CGCAACAGTCCCCATTATGAACGTCTCAAGAAAAGCGGCGATTGTCGATTTGGCATACTGACCCAAGTAGTCAAT
AATGACTCAGTGCGAAAGAATCATGGGCAGTACCTGTCAAATGTTTGTCTAAAGGTCAACGCAAAACTAGGCGGT
GCAACGTCGCGCACGCCACCTCCATGGAAGTCGACTCCGCATTACTTTCCGGCGGATCGGCCAACCATGATCATT
GGTGTCGACATCTCGCACCCGCCTCCAGGTGGCACATCACCGTCAACTGCGGCCATGACTATGTCTTTGGATCGT
GATGCTACACGATATGGTGCCATGGTCGAGTCAAACGGCTACCGTAAGGAGATGCTGGAGGCCGTCAATGTGCAC
ACCTTCATGAATCATTTGAGCAATCTCTGGCGCAGTGCACATGGTGGTGGCGCCTTTCCTCGACACATCATCTAC
TTCAGAGATGGCGTTTCGGAGGGACAGTTTGCCCATGTCTTGGACCAGGAAATTGGCCAGATTCGCGCGTGGTTT
GACGAGAATGCCAAGGGCAAGCCGATGCCAAAGTTCACGGTTGTGATTGCAACCAAGCGACATCATATCCGCTTT
TTCCCGCCCAGCAACAGCCGAGATGCTGATCGTAATGGCAATCCTCTGCCAGGAACGTTGGTGGAGCGTGAAGTT
ACACATCCGTTTATGTGGGACTTCTACCTGAATTCTCACGCGGCTATTCAGGGTACTGCCAGGCCCGTGCATTAC
CACATTATTCTGGACGAGATGGGAGTGCCAGCAAATGACTTTCAGAAAATGATCTACCATCAGTGCTATACTTAT
GCACGCTCGACTACTCCGGTGTCGTTGCATCCGGCAGTTTATTACGCGCATTTGGCTGGCGCGCGGGCTCGCTGC
CATGAGAATGTTTCTGCGGGCCTCGGGTATCGACACGGTGGCAAGGGCCACGAGGTGATCCAGGAAAGGATTGCT
CGGGGAGTGACAATGGGAGGCCCTTCGGATGATGGCGTCCCACGCGCTCTGTTGACTTTGGGTGGAGAAGTGGAT
GGTGAGAAGGGCGCAGTTGAAGGGGAGCAGCGTCAGCGAAACTTCTTTCGAAGCACTATGTGGTACATGTAG
Gene >OphauB2|2045
ATGTCCGACAGAGGTCGTTCTCCCGCGGCCTCGGGCGGGCCCGCTGGGGCGTCGCGGGCCGCTCAAATGTCAATG
AGCCGTGATAATTCTTCCGCAAGCTCGCAAGCCAAGGATCCTTCCAAAAGCTGGTCTCCTGGCATGGGATTCGAT
CCGGCAAAGCCTGCCGCCAAGGCTGACAAAGGCAACACGCGCATGGAATTGCCTCCGGACGCATTCGTACCTGAC
ACGCAGAAGAGTCGCTTTGCTCTACGCAACAACAAGATGAACACAGAGGGAAAGCCAATTCCCATTGAAGTGAAT
CAATATCGTATGAAGAGCTTCGACTCTTCCAAGAAGATCTACCAATACGATGTCAGTATACTCTTGCGTTTGCAA
AAGCGTCTTCGTCACTAACATGGCCTAGGTCCTTATATCTCCCGACACTGAGAAGAAGGCTGTTGTGTTGAAGAA
GATTTGGCAGCACCCAACTACCAAGAAGTTTCTTGAAAAGTACAGTTTCCCCAAGTGGATTTTTGATGGACGCAA
GCTGGCTTGGGCGCCCGCCCTGCTCGATCGTGGCGAAATTCGTTTCGCCGTCGATCTTGATGAGGGCAAACGTCC
ACCTAATGCTCCAGCCCGAGAGGGCAACAAGTTTCTTATCATGATCAGAAAGACCACGACCATTGATGTCTCGGT
GCTGCGTGGATATCTTGATAACAAGGTTTCTTTCAGCACGGCTGTCCAAGAGGCGCTCAATTTTCTCGACCACTT
GCTGCGTCAATGGCCCTCTCAGCGCATGCTTTGCATCAAGCGCAACTTTTACAATGAGCAAGGCTCGGGTATAGC
CCTAAATCCGGCTCCCAGCTACGTTGAAGTTCACAAGGGCCTGTATGCGTCTATTCGGCTTAGTCACAATCTCAA
GAACGGCGGTATTGGCTTGGCACTGAATGCCGATGTCGTCAACACATGCTTCTGGGCAGCCCCATGGACTGTTGC
CCAGATGGTTGGCCCATATCTCCATGGATGCGATTCGCGTCGCTGGCACGGACTGCTTCCAGAGAATATGTCGCG
AGAATTTCGTCCTGTTAAACAAGGGGACCAATGGGGCTCCTCGGACGCATTTAAGCATCTGCGCAAGCTTCGCCG
TTTGAGGTTCAAGGTGCAGCATCCGAACCGCGCCAACTCGGACACTGTTTACTCGATTCAGGACTTTGTCTTCGA
CCAAGGATACGGGTCAGAGGGCGCCACGGCTGCAACTGTTTCGTTTGATTGTAATGGTAAGAAGATGACCATTCG
CGACTACTACATGAGTCGCTACAAGGCCCATTTGATGTACCCAAATCTGCCGGTCATCGACGCCGGAAAAGGCCG
TTACTTCCCCTTCGAATTCGCATACCTGGAGCCTCTCCAGAGGTACCCCTTCAAGCTCAATCCCGAGCAGACGGC
TGCCATGATCAAGCTGGCGGTGACTCGCCCCGCAGTCAGACGCTCAGACATTCAGAAGGGTGTAGACTCTTTGCA
GCTACAGCAAGACCCATTCCTCAAGGAGTATGGGGTTCAATTCGAACCAGGCTTTACAAGGACGGAGGCGCGTCT
GTTGCCACCTCCGAAGGTTGAGTTTGGCCAGGGCAGTGGCGTGGTCGAGCCCAAGTTCTCGGGTCGTTGGGACTT
GCGAGGCAAGAAGTTTTTCAAGCAGAATGCGGCACCCATGGCCAGCTGGGGGTTCATCGCGATGAACAACTGCGT
GGACTATCCAAGCCTTCAGAATTTCGCCAAGTCCTTTCGCCAGTCCTTTTTGGCACATGGCGGCAACTGTTCACA
AGAGGCAATGCTCATGAATGTTCCGCCCAACTTCAGAGACAATATCGCAGGCGCAATGGCCTGGGCCGTCGAAGA
AATGACCAGGCAACGGGGATATCCTCAGCTTCTCTTCGTTGTTGTTGCGCATCGCAACAGTCCCCATTATGAACG
TCTCAAGAAAAGCGGCGATTGTCGATTTGGCATACTGACCCAAGTAGTCAATAATGACTCAGTGCGAAAGAATCA
TGGGCAGTACCTGTCAAATGTTTGTCTAAAGGTCAACGCAAAACTAGGCGGTGCAACGTCGCGCACGCCACCTCC
ATGGAAGTCGACTCCGCATTACTTTCCGGCGGATCGGCCAACCATGATCATTGGTGTCGACATCTCGCACCCGCC
TCCAGGTGGCACATCACCGTCAACTGCGGCCATGACTATGTCTTTGGATCGTGATGCTACACGATATGGTGCCAT
GGTCGAGTCAAACGGCTACCGTAAGGAGATGCTGGAGGCCGTCAATGTGCACACCTTCATGAATCATTTGAGCAA
TCTCTGGCGCAGTGCACATGGTGGTGGCGCCTTTCCTCGACACATCATCTACTTCAGAGATGGCGTTTCGGAGGG
ACAGTTTGCCCATGTCTTGGACCAGGAAATTGGCCAGATTCGCGCGTGGTTTGACGAGAATGCCAAGGGCAAGCC
GATGCCAAAGTTCACGGTTGTGATTGCAACCAAGCGACATCATATCCGCTTTTTCCCGCCCAGCAACAGCCGAGA
TGCTGATCGTAATGGCAATCCTCTGCCAGGAACGTTGGTGGAGCGTGAAGTTACACATCCGTTTATGTGGGACTT
CTACCTGAATTCTCACGCGGCTATTCAGGGTACTGCCAGGCCCGTGCATTACCACATTATTCTGGACGAGATGGG
AGTGCCAGCAAATGACTTTCAGAAAATGATCTACCATCAGTGCTATACTTATGCACGCTCGACTACTCCGGTGTC
GTTGCATCCGGCAGTTTATTACGCGCATTTGGCTGGCGCGCGGGCTCGCTGCCATGAGAATGTTTCTGCGGGCCT
CGGGTATCGACACGGTGGCAAGGGCCACGAGGTGATCCAGGAAAGGATTGCTCGGGGAGTGACAATGGGAGGCCC
TTCGGATGATGGCGTCCCACGCGCTCTGTTGACTTTGGGTGGAGAAGTGGATGGTGAGAAGGGCGCAGTTGAAGG
GGAGCAGCGTCAGCGAAACTTCTTTCGAAGCACTATGTGGTACATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail