Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2031
Gene name
LocationContig_16:194405..195532
Strand-
Gene length (bp)1127
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal 1.1E-19 15 138
PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily 1.3E-17 187 293

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 32 333 3.0E-23
sp|Q7XZQ8|FNSI_PETCR Flavone synthase OS=Petroselinum crispum GN=FNSI PE=1 SV=1 21 312 2.0E-22
sp|Q7XZQ7|FL3H_PETCR Flavanone 3-dioxygenase OS=Petroselinum crispum GN=FHT PE=1 SV=1 28 317 6.0E-21
sp|P41090|FL3H_VITVI Naringenin,2-oxoglutarate 3-dioxygenase OS=Vitis vinifera GN=F3H PE=2 SV=1 29 317 1.0E-20
sp|Q9S818|FL3H_ARATH Naringenin,2-oxoglutarate 3-dioxygenase OS=Arabidopsis thaliana GN=F3H PE=1 SV=1 26 312 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 32 333 3.0E-23
sp|Q7XZQ8|FNSI_PETCR Flavone synthase OS=Petroselinum crispum GN=FNSI PE=1 SV=1 21 312 2.0E-22
sp|Q7XZQ7|FL3H_PETCR Flavanone 3-dioxygenase OS=Petroselinum crispum GN=FHT PE=1 SV=1 28 317 6.0E-21
sp|P41090|FL3H_VITVI Naringenin,2-oxoglutarate 3-dioxygenase OS=Vitis vinifera GN=F3H PE=2 SV=1 29 317 1.0E-20
sp|Q9S818|FL3H_ARATH Naringenin,2-oxoglutarate 3-dioxygenase OS=Arabidopsis thaliana GN=F3H PE=1 SV=1 26 312 3.0E-20
sp|Q8LEA2|G2OX1_ARATH Gibberellin 2-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA2OX1 PE=2 SV=2 35 324 8.0E-20
sp|Q05965|FL3H_MATIN Naringenin,2-oxoglutarate 3-dioxygenase (Fragment) OS=Matthiola incana GN=FHT PE=2 SV=1 26 312 8.0E-20
sp|O49561|G2OX8_ARATH Gibberellin 2-beta-dioxygenase 8 OS=Arabidopsis thaliana GN=GA2OX8 PE=1 SV=2 14 327 1.0E-19
sp|Q96330|FLS1_ARATH Flavonol synthase/flavanone 3-hydroxylase OS=Arabidopsis thaliana GN=FLS1 PE=1 SV=1 28 329 2.0E-19
sp|Q06942|FL3H_MALDO Naringenin,2-oxoglutarate 3-dioxygenase OS=Malus domestica PE=2 SV=1 26 317 2.0E-19
sp|Q07353|FL3H_PETHY Naringenin,2-oxoglutarate 3-dioxygenase (Fragment) OS=Petunia hybrida GN=AN3 PE=1 SV=1 19 312 3.0E-19
sp|Q9C7Z1|G2OX4_ARATH Gibberellin 2-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA2OX4 PE=2 SV=1 25 331 5.0E-19
sp|Q9ZWQ9|FLS_CITUN Flavonol synthase/flavanone 3-hydroxylase OS=Citrus unshiu GN=FLS PE=1 SV=1 24 329 5.0E-19
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 31 296 8.0E-19
sp|Q9XFR9|G2OX2_ARATH Gibberellin 2-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA2OX2 PE=2 SV=1 35 325 2.0E-18
sp|Q84MB6|DIOX2_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g50210 PE=2 SV=1 21 296 2.0E-17
sp|O04395|FLS_MATIN Flavonol synthase/flavanone 3-hydroxylase (Fragment) OS=Matthiola incana PE=2 SV=1 28 329 3.0E-17
sp|Q05963|FL3H_CALCH Naringenin,2-oxoglutarate 3-dioxygenase OS=Callistephus chinensis GN=FHT PE=2 SV=1 24 312 3.0E-17
sp|Q05964|FL3H_DIACA Naringenin,2-oxoglutarate 3-dioxygenase OS=Dianthus caryophyllus GN=FHT PE=2 SV=1 24 317 6.0E-17
sp|P28038|FL3H_HORVU Naringenin,2-oxoglutarate 3-dioxygenase OS=Hordeum vulgare PE=2 SV=1 24 317 7.0E-17
sp|A6BM06|ACCO1_DICMU 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium mucoroides GN=aco PE=3 SV=1 15 322 8.0E-17
sp|Q76NT9|ACCO1_DICDI 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium discoideum GN=aco PE=2 SV=1 15 322 8.0E-17
sp|Q9FFQ4|FLS5_ARATH Probable flavonol synthase 5 OS=Arabidopsis thaliana GN=FLS5 PE=2 SV=1 31 329 8.0E-17
sp|Q9C6I4|G2OX7_ARATH Gibberellin 2-beta-dioxygenase 7 OS=Arabidopsis thaliana GN=GA2OX7 PE=1 SV=1 7 327 1.0E-16
sp|Q9XG83|G2OX_PHACN Gibberellin 2-beta-dioxygenase OS=Phaseolus coccineus GN=GA2OX1 PE=2 SV=1 35 326 2.0E-16
sp|Q9C899|F6H2_ARATH Feruloyl CoA ortho-hydroxylase 2 OS=Arabidopsis thaliana GN=F6'H2 PE=1 SV=1 43 324 2.0E-16
sp|Q39224|SRG1_ARATH Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1 25 325 5.0E-16
sp|Q39111|GAOX2_ARATH Gibberellin 20 oxidase 2 OS=Arabidopsis thaliana GN=GA20OX2 PE=2 SV=1 43 320 5.0E-16
sp|Q39110|GAOX1_ARATH Gibberellin 20 oxidase 1 OS=Arabidopsis thaliana GN=GA20OX1 PE=2 SV=2 12 297 1.0E-15
sp|Q39112|GAOX3_ARATH Gibberellin 20 oxidase 3 OS=Arabidopsis thaliana GN=GA20OX3 PE=2 SV=1 12 296 1.0E-15
sp|Q9SQ80|G2OX1_PEA Gibberellin 2-beta-dioxygenase 1 OS=Pisum sativum GN=GA2OX1 PE=1 SV=1 35 324 2.0E-15
sp|P27744|IPNS_AMYLA Isopenicillin N synthase OS=Amycolatopsis lactamdurans GN=pcbC PE=3 SV=1 12 292 4.0E-15
sp|Q07512|FLS_PETHY Flavonol synthase/flavanone 3-hydroxylase OS=Petunia hybrida GN=FL PE=2 SV=1 28 318 5.0E-15
sp|O04705|GAO1D_WHEAT Gibberellin 20 oxidase 1-D OS=Triticum aestivum GN=GA20ox1D PE=1 SV=1 12 322 6.0E-15
sp|Q9LTH8|ACH11_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 11 OS=Arabidopsis thaliana GN=At5g59530 PE=2 SV=1 12 326 6.0E-15
sp|O04707|GAO1A_WHEAT Gibberellin 20 oxidase 1-A OS=Triticum aestivum GN=GA20ox1A PE=2 SV=1 12 315 8.0E-15
sp|Q43383|ACCH5_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 5 OS=Arabidopsis thaliana GN=2A6 PE=2 SV=2 43 325 9.0E-15
sp|Q8H113|DIN11_ARATH Probable 2-oxoglutarate-dependent dioxygenase DIN11 OS=Arabidopsis thaliana GN=DIN11 PE=2 SV=1 21 307 1.0E-14
sp|Q9FZ21|G2OX6_ARATH Gibberellin 2-beta-dioxygenase 6 OS=Arabidopsis thaliana GN=GA2OX6 PE=2 SV=1 183 322 1.0E-14
sp|P10621|IPNS_STRC2 Isopenicillin N synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=pcbC PE=3 SV=1 1 292 2.0E-14
sp|P40902|ISP7_SCHPO Sexual differentiation process protein isp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp7 PE=2 SV=1 11 305 2.0E-14
sp|O04706|GAO1B_WHEAT Gibberellin 20 oxidase 1-B OS=Triticum aestivum GN=GA20ox1B PE=2 SV=1 12 322 2.0E-14
sp|Q9LHN8|F6H1_ARATH Feruloyl CoA ortho-hydroxylase 1 OS=Arabidopsis thaliana GN=F6'H1 PE=1 SV=1 28 324 2.0E-14
sp|P51091|LDOX_MALDO Leucoanthocyanidin dioxygenase OS=Malus domestica GN=ANS PE=2 SV=1 5 329 4.0E-14
sp|O04274|LDOX_PERFR Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1 5 316 5.0E-14
sp|F4IY03|DIOX1_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g49630 PE=3 SV=1 21 307 7.0E-14
sp|Q0JH50|GAOX2_ORYSJ Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. japonica GN=20ox2 PE=1 SV=1 43 322 1.0E-13
sp|P0C5H5|GAOX2_ORYSI Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. indica GN=20ox2 PE=1 SV=1 43 322 1.0E-13
sp|F4K7D5|FLS6_ARATH Probable flavonol synthase 6 OS=Arabidopsis thaliana GN=FLS6 PE=3 SV=1 27 330 1.0E-13
sp|Q41452|FLS_SOLTU Flavonol synthase/flavanone 3-hydroxylase OS=Solanum tuberosum PE=2 SV=1 21 318 1.0E-13
sp|P16020|IPNS_FLASS Isopenicillin N synthase OS=Flavobacterium sp. (strain SC 12,154) GN=pcbC PE=3 SV=1 12 294 2.0E-13
sp|D4N502|DIOX3_PAPSO Codeine O-demethylase OS=Papaver somniferum GN=CODM PE=1 SV=1 43 319 3.0E-13
sp|D4N501|DIOX2_PAPSO Probable 2-oxoglutarate/Fe(II)-dependent dioxygenase OS=Papaver somniferum GN=DIOX2 PE=2 SV=1 12 313 3.0E-13
sp|Q9M547|FLS_EUSER Flavonol synthase/flavanone 3-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=FLS PE=2 SV=1 33 329 3.0E-13
sp|Q9C955|GAOX4_ARATH Gibberellin 20 oxidase 4 OS=Arabidopsis thaliana GN=GA20OX4 PE=2 SV=1 12 295 3.0E-13
sp|Q48739|IPNS_LYSLA Isopenicillin N synthase OS=Lysobacter lactamgenus GN=pcbC PE=3 SV=1 12 294 4.0E-13
sp|Q7XZQ6|FLS_PETCR Flavonol synthase/flavanone 3-hydroxylase OS=Petroselinum crispum GN=FLS PE=1 SV=1 21 275 7.0E-13
sp|Q96323|LDOX_ARATH Leucoanthocyanidin dioxygenase OS=Arabidopsis thaliana GN=LDOX PE=1 SV=1 5 297 2.0E-12
sp|Q9LTH7|ACH12_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 12 OS=Arabidopsis thaliana GN=At5g59540 PE=2 SV=1 12 326 2.0E-12
sp|Q9LSW7|ACCH9_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 9 OS=Arabidopsis thaliana GN=At5g43440 PE=2 SV=1 22 325 2.0E-12
sp|A2A1A0|NCS1_COPJA S-norcoclaurine synthase 1 OS=Coptis japonica GN=NCS1 PE=1 SV=1 28 324 3.0E-12
sp|P51092|LDOX_PETHY Leucoanthocyanidin dioxygenase OS=Petunia hybrida GN=ANT17 PE=2 SV=1 5 316 3.0E-12
sp|Q9M2C4|ACCH8_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 8 OS=Arabidopsis thaliana GN=At3g61400 PE=2 SV=1 24 324 3.0E-12
sp|Q9XHG2|FLS_MALDO Flavonol synthase/flavanone 3-hydroxylase OS=Malus domestica GN=FLS PE=2 SV=1 28 317 6.0E-12
sp|Q40062|IDS3_HORVU 2'-deoxymugineic-acid 2'-dioxygenase OS=Hordeum vulgare GN=IDS3 PE=1 SV=3 42 316 8.0E-12
sp|Q9SVS8|G3OX3_ARATH Gibberellin 3-beta-dioxygenase 3 OS=Arabidopsis thaliana GN=GA3OX3 PE=2 SV=1 43 328 8.0E-12
sp|Q94A78|ACCH4_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 4 OS=Arabidopsis thaliana GN=At1g03400 PE=2 SV=1 43 290 8.0E-12
sp|Q84MB3|ACCH1_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 1 OS=Arabidopsis thaliana GN=At1g06620 PE=2 SV=1 22 326 1.0E-11
sp|P93821|ACCH7_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 7 OS=Arabidopsis thaliana GN=At1g04380 PE=1 SV=1 5 326 1.0E-11
sp|Q9XHM5|G2OX2_PEA Gibberellin 2-beta-dioxygenase 2 OS=Pisum sativum GN=GA2OX2 PE=2 SV=1 28 295 2.0E-11
sp|Q9LSW6|ACH10_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 10 OS=Arabidopsis thaliana GN=At5g43450 PE=2 SV=1 5 324 2.0E-11
sp|P08703|IPNS_PENCH Isopenicillin N synthase OS=Penicillium chrysogenum GN=pcbC PE=3 SV=1 133 292 3.0E-11
sp|P18286|IPNS_STRJU Isopenicillin N synthase OS=Streptomyces jumonjinensis GN=pcbC PE=3 SV=1 1 292 3.0E-11
sp|Q9FFQ5|FLS3_ARATH Flavonol synthase 3 OS=Arabidopsis thaliana GN=FLS3 PE=2 SV=1 28 317 3.0E-11
sp|Q4PT02|GAOX5_ARATH Gibberellin 20 oxidase 5 OS=Arabidopsis thaliana GN=GA20OX5 PE=2 SV=1 4 295 6.0E-11
sp|Q40061|IDS2_HORVU Mugineic-acid 3-dioxygenase OS=Hordeum vulgare GN=IDS2 PE=2 SV=1 14 327 1.0E-10
sp|A2Z1W9|ACCO1_ORYSI 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. indica GN=ACO1 PE=2 SV=1 100 316 2.0E-10
sp|Q54243|IPNS_STRGR Isopenicillin N synthase OS=Streptomyces griseus GN=pcbC PE=3 SV=1 12 292 3.0E-10
sp|Q7XKU5|DAO_ORYSJ 2-oxoglutarate-dependent dioxygenase DAO OS=Oryza sativa subsp. japonica GN=DAO PE=2 SV=2 142 329 4.0E-10
sp|Q01IX6|DAO_ORYSI 2-oxoglutarate-dependent dioxygenase DAO OS=Oryza sativa subsp. indica GN=DAO PE=3 SV=1 142 329 4.0E-10
sp|Q3I409|G3O23_WHEAT Gibberellin 3-beta-dioxygenase 2-3 OS=Triticum aestivum GN=GA3ox2-3 PE=2 SV=1 28 304 4.0E-10
sp|P93771|GAOX1_ORYSJ Gibberellin 20 oxidase 1 OS=Oryza sativa subsp. japonica GN=20ox1 PE=2 SV=2 43 295 4.0E-10
sp|Q8XPV7|EFE_RALSO 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Ralstonia solanacearum (strain GMI1000) GN=efe PE=3 SV=1 14 296 4.0E-10
sp|P05189|IPNS_ACRCH Isopenicillin N synthase OS=Acremonium chrysogenum GN=PCBC PE=1 SV=1 12 292 6.0E-10
sp|Q9C971|G3OX4_ARATH Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA3OX4 PE=1 SV=1 35 328 6.0E-10
sp|Q06588|ACCO4_ARATH 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Arabidopsis thaliana GN=ACO4 PE=1 SV=2 43 295 7.0E-10
sp|P93824|ACCH6_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 6 OS=Arabidopsis thaliana GN=At1g04350 PE=2 SV=1 12 326 8.0E-10
sp|Q3I411|G3O21_WHEAT Gibberellin 3-beta-dioxygenase 2-1 OS=Triticum aestivum GN=GA3ox2-1 PE=1 SV=1 135 304 1.0E-09
sp|D4N500|DIOX1_PAPSO Thebaine 6-O-demethylase OS=Papaver somniferum GN=T6ODM PE=1 SV=1 43 314 1.0E-09
sp|Q3I410|G3O22_WHEAT Gibberellin 3-beta-dioxygenase 2-2 OS=Triticum aestivum GN=GA3ox2-2 PE=2 SV=1 135 304 1.0E-09
sp|Q0J1C1|ACCO1_ORYSJ 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. japonica GN=ACO1 PE=2 SV=1 100 316 1.0E-09
sp|Q39103|G3OX1_ARATH Gibberellin 3-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA3OX1 PE=1 SV=2 43 328 2.0E-09
sp|Q8H1S4|ACCH3_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 3 OS=Arabidopsis thaliana GN=At1g06650 PE=2 SV=1 136 324 2.0E-09
sp|Q41931|ACCO2_ARATH 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Arabidopsis thaliana GN=ACO2 PE=2 SV=2 130 316 2.0E-09
sp|P12438|IPNS_STRMI Isopenicillin N synthase OS=Streptomyces microflavus GN=pcbC PE=3 SV=1 1 292 2.0E-09
sp|O64692|G2OX3_ARATH Gibberellin 2-beta-dioxygenase 3 OS=Arabidopsis thaliana GN=GA2OX3 PE=2 SV=1 34 325 2.0E-09
sp|P05326|IPNS_EMENI Isopenicillin N synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ipnA PE=1 SV=1 8 292 3.0E-09
sp|P31237|ACCO_ACTDE 1-aminocyclopropane-1-carboxylate oxidase OS=Actinidia deliciosa GN=ACO PE=2 SV=1 139 295 4.0E-09
sp|P10967|ACCH3_SOLLC 1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1 173 325 4.0E-09
sp|P07920|ACCO2_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Solanum lycopersicum GN=ACO2 PE=2 SV=1 43 295 5.0E-09
sp|Q0WPW4|ACCO5_ARATH 1-aminocyclopropane-1-carboxylate oxidase 5 OS=Arabidopsis thaliana GN=At1g77330 PE=2 SV=1 12 316 8.0E-09
sp|Q9Z3T0|EFE_PSESJ 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas syringae pv. pisi GN=efe PE=3 SV=1 125 296 8.0E-09
sp|Q9ZT84|G3OX2_ARATH Gibberellin 3-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA3OX2 PE=1 SV=2 186 328 9.0E-09
sp|Q09052|ACCO1_BRAJU 1-aminocyclopropane-1-carboxylate oxidase OS=Brassica juncea GN=ACO PE=2 SV=1 136 295 1.0E-08
sp|Q9C5K7|ACCH2_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 2 OS=Arabidopsis thaliana GN=At1g06640 PE=2 SV=1 43 324 2.0E-08
sp|P31528|ACCO_DIACA Probable 1-aminocyclopropane-1-carboxylate oxidase OS=Dianthus caryophyllus GN=ACO PE=2 SV=1 136 312 2.0E-08
sp|P32021|EFE_PSESH 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas savastanoi pv. phaseolicola GN=efe PE=1 SV=1 126 296 3.0E-08
sp|Q7BS32|EFE_PSESG 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas savastanoi pv. glycinea GN=efe PE=1 SV=1 126 296 3.0E-08
sp|Q7BS31|EFE_PSECA 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas cannabina GN=efe PE=3 SV=1 126 296 3.0E-08
sp|Q9Z377|EFE_PSEAQ 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Pseudomonas amygdali pv. sesami GN=efe PE=3 SV=1 126 296 3.0E-08
sp|Q08506|ACCO1_PETHY 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Petunia hybrida GN=ACO1 PE=1 SV=1 43 308 4.0E-08
sp|O04847|DV4H_CATRO Deacetoxyvindoline 4-hydroxylase OS=Catharanthus roseus GN=D4H PE=1 SV=2 21 324 5.0E-08
sp|P19464|ACCO_PERAE 1-aminocyclopropane-1-carboxylate oxidase OS=Persea americana GN=ACO PE=2 SV=1 139 295 8.0E-08
sp|O65378|ACCO3_ARATH 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Arabidopsis thaliana GN=At1g12010 PE=2 SV=1 140 316 9.0E-08
sp|Q8S932|ACCO_DIOKA 1-aminocyclopropane-1-carboxylate oxidase OS=Diospyros kaki GN=DK-ACO1 PE=2 SV=1 43 295 9.0E-08
sp|Q9FR99|ACCO_MUSAC 1-aminocyclopropane-1-carboxylate oxidase OS=Musa acuminata GN=MAO1B PE=3 SV=1 12 296 1.0E-07
sp|P54847|ACCO3_CUCME 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Cucumis melo GN=ACO3 PE=2 SV=1 144 315 1.0E-07
sp|Q9MB94|ACCO_PRUMU 1-aminocyclopropane-1-carboxylate oxidase OS=Prunus mume GN=ACO1 PE=2 SV=1 136 308 2.0E-07
sp|Q08508|ACCO4_PETHY 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Petunia hybrida GN=ACO4 PE=3 SV=1 21 315 3.0E-07
sp|Q43792|ACCO_TOBAC 1-aminocyclopropane-1-carboxylate oxidase OS=Nicotiana tabacum GN=ACO PE=2 SV=1 136 308 3.0E-07
sp|Q9SKK4|GSL_ARATH Probable 2-oxoacid dependent dioxygenase OS=Arabidopsis thaliana GN=GSL-OH PE=2 SV=1 5 292 5.0E-07
sp|Q08507|ACCO3_PETHY 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Petunia hybrida GN=ACO3 PE=3 SV=1 144 308 6.0E-07
sp|O24648|G3OX_PEA Gibberellin 3-beta-dioxygenase 1 OS=Pisum sativum GN=LE PE=1 SV=1 43 324 1.0E-06
sp|P24157|ACCO4_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Solanum lycopersicum GN=ACO4 PE=2 SV=1 144 316 1.0E-06
sp|P31238|ACCO1_DORSP 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Doritaenopsis sp. GN=ACO1 PE=2 SV=1 145 295 2.0E-06
sp|P05116|ACCO1_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Solanum lycopersicum GN=ACO1 PE=2 SV=2 144 295 2.0E-06
sp|P31239|ACCO_PEA 1-aminocyclopropane-1-carboxylate oxidase OS=Pisum sativum GN=ACO PE=2 SV=1 206 313 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2031
MTLLKPSSGGIVRTLDFAEFLANDSGTQEKFCQELVGCLSSVGFVKLLNHGIDKGDLSKVFEWNRRFFSLPLAAK
SKAAHPPEANPHRGYSYVGQEKLSMVKDYEKGVREAVANYDIKESFDQGPVCDELYQNRWPDESDIPGFRVFMEF
FYERCHEVHQCILQALAVGLGLDRTLLLDLCDRNTAELRMNHYPLYDASQVRPGAKRISEHTDFGTITMLFQDSV
GGLEVEDQSMPGRYLPVPCDDTSEMVVNIGDCLQRWTNGKFLSTSHRVVLPDGVNARVEERYSVAYFGKPNRLQN
VGTLPIFVRDGETPKYENISAWEYNQEKLILTY*
Coding >OphauB2|2031
ATGACCCTCCTCAAACCGAGCTCAGGTGGCATTGTCCGCACATTGGACTTTGCCGAGTTTCTCGCAAACGATTCA
GGCACACAGGAAAAATTCTGCCAAGAGCTTGTCGGGTGCCTCAGCAGCGTGGGGTTCGTGAAGCTTCTTAATCAT
GGAATTGACAAGGGGGATCTAAGCAAAGTATTTGAATGGAACCGCCGGTTTTTTTCACTTCCATTAGCCGCCAAG
TCAAAGGCTGCACACCCTCCCGAGGCCAACCCCCATCGTGGCTATAGCTATGTTGGCCAAGAGAAATTATCCATG
GTAAAGGACTACGAGAAAGGGGTTCGAGAAGCGGTTGCCAATTATGACATCAAAGAGTCGTTCGACCAAGGCCCG
GTGTGCGACGAGCTTTACCAGAATCGGTGGCCAGATGAGAGCGATATTCCGGGCTTCCGAGTATTCATGGAATTC
TTTTATGAGCGCTGCCATGAAGTGCACCAATGCATCCTTCAAGCCCTTGCGGTCGGCCTTGGCCTCGATCGGACC
TTACTGCTAGACCTATGTGATCGAAACACGGCCGAGCTTCGCATGAATCACTATCCACTGTATGACGCTTCCCAG
GTCAGGCCAGGTGCCAAGAGAATTTCTGAGCACACAGATTTCGGTACGATCACTATGCTCTTCCAGGATTCTGTA
GGTGGACTGGAAGTAGAAGACCAAAGTATGCCAGGACGCTACCTTCCTGTCCCTTGCGATGACACGTCGGAGATG
GTTGTCAACATTGGCGACTGCCTTCAGCGTTGGACCAACGGCAAATTTCTTTCGACTAGCCACCGTGTCGTTCTT
CCTGACGGGGTGAACGCCCGAGTGGAGGAGAGGTACTCGGTGGCGTATTTCGGTAAGCCGAATCGCTTACAAAAT
GTTGGCACCTTGCCCATTTTTGTGCGAGACGGTGAGACACCCAAATACGAGAACATTTCCGCCTGGGAATACAAC
CAGGAAAAGCTTATTCTGACCTACTAA
Transcript >OphauB2|2031
ATGACCCTCCTCAAACCGAGCTCAGGTGGCATTGTCCGCACATTGGACTTTGCCGAGTTTCTCGCAAACGATTCA
GGCACACAGGAAAAATTCTGCCAAGAGCTTGTCGGGTGCCTCAGCAGCGTGGGGTTCGTGAAGCTTCTTAATCAT
GGAATTGACAAGGGGGATCTAAGCAAAGTATTTGAATGGAACCGCCGGTTTTTTTCACTTCCATTAGCCGCCAAG
TCAAAGGCTGCACACCCTCCCGAGGCCAACCCCCATCGTGGCTATAGCTATGTTGGCCAAGAGAAATTATCCATG
GTAAAGGACTACGAGAAAGGGGTTCGAGAAGCGGTTGCCAATTATGACATCAAAGAGTCGTTCGACCAAGGCCCG
GTGTGCGACGAGCTTTACCAGAATCGGTGGCCAGATGAGAGCGATATTCCGGGCTTCCGAGTATTCATGGAATTC
TTTTATGAGCGCTGCCATGAAGTGCACCAATGCATCCTTCAAGCCCTTGCGGTCGGCCTTGGCCTCGATCGGACC
TTACTGCTAGACCTATGTGATCGAAACACGGCCGAGCTTCGCATGAATCACTATCCACTGTATGACGCTTCCCAG
GTCAGGCCAGGTGCCAAGAGAATTTCTGAGCACACAGATTTCGGTACGATCACTATGCTCTTCCAGGATTCTGTA
GGTGGACTGGAAGTAGAAGACCAAAGTATGCCAGGACGCTACCTTCCTGTCCCTTGCGATGACACGTCGGAGATG
GTTGTCAACATTGGCGACTGCCTTCAGCGTTGGACCAACGGCAAATTTCTTTCGACTAGCCACCGTGTCGTTCTT
CCTGACGGGGTGAACGCCCGAGTGGAGGAGAGGTACTCGGTGGCGTATTTCGGTAAGCCGAATCGCTTACAAAAT
GTTGGCACCTTGCCCATTTTTGTGCGAGACGGTGAGACACCCAAATACGAGAACATTTCCGCCTGGGAATACAAC
CAGGAAAAGCTTATTCTGACCTACTAA
Gene >OphauB2|2031
ATGACCCTCCTCAAACCGAGCTCAGGTGGCATTGTCCGCACATTGGACTTTGCCGAGTTTCTCGCAAACGATTCA
GGCACACAGGAAAAATTCTGCCAAGAGCTTGTCGGGTGCCTCAGCAGCGTGGGGTTCGTGAAGCTTCTTAATCAT
GGAATTGACAAGGGGGATCTAAGCAAAGTATTTGAATGGGTGAGATATAGTAGCCAGTCCACAGACACTGGGGCG
GGCTGACTTGGTGTTCACACCTTTCAGAACCGCCGGTTTTTTTCACTTCCATTAGCCGCCAAGTCAAAGGCTGCA
CACCCTCCCGAGGCCAACCCCCATCGTGGCTATAGCTATGTTGGCCAAGAGAAATTATCCATGGTAAAGGACTAC
GAGAAAGGGGTTCGAGAAGCGGTTGCCAATTATGACATCAAAGTAGGCGTCTAGTTCACTGTCTAATCCCAACTC
ATCACATTTGTCTCACATTTTTACCCCAGGAGTCGTTCGACCAAGGCCCGGTGTGCGACGAGCTTTACCAGAATC
GGTGGCCAGATGAGAGCGATATTCCGGGCTTCCGAGTATTCATGGAATTCTTTTATGAGCGCTGCCATGAAGTGC
ACCAATGCATCCTTCAAGCCCTTGCGGTCGGCCTTGGCCTCGATCGGACCTTACTGCTAGACCTATGTGATCGAA
ACACGGCCGAGCTTCGCATGAATCACTATCCACTGTATGACGCTTCCCAGGTCAGGCCAGGTGCCAAGAGAATTT
CTGAGCACACAGATTTCGGTACGATCACTATGCTCTTCCAGGATTCTGTAGGTGGACTGGAAGTAGAAGACCAAA
GTATGCCAGGACGCTACCTTCCTGTCCCTTGCGATGACACGTCGGAGATGGTTGTCAACATTGGCGACTGCCTTC
AGCGTTGGACCAACGGCAAATTTCTTTCGACTAGCCACCGTGTCGTTCTTCCTGACGGGGTGAACGCCCGAGTGG
AGGAGAGGTACTCGGTGGCGTATTTCGGTAAGCCGAATCGCTTACAAAATGTTGGCACCTTGCCCATTTTTGTGC
GAGACGGTGAGACACCCAAATACGAGAACATTTCCGCCTGGGAATACAACCAGGAAAAGCTTATTCTGACCTACT
AA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail