Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2029
Gene name
LocationContig_16:183620..191162
Strand-
Gene length (bp)7542
Transcript length (bp)7542
Coding sequence length (bp)7542
Protein length (aa) 2514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 4.4E-97 33 423
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 9.7E-84 620 872
PF08659 KR KR domain 1.5E-55 1763 1942
PF00698 Acyl_transf_1 Acyl transferase domain 9.7E-57 1186 1508
PF07993 NAD_binding_4 Male sterility protein 5.0E-49 2167 2396
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 3.0E-42 880 998
PF00550 PP-binding Phosphopantetheine attachment site 3.4E-12 535 598
PF00550 PP-binding Phosphopantetheine attachment site 1.4E-07 2048 2113
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.8E-11 2165 2343
PF00106 adh_short short chain dehydrogenase 1.5E-11 1764 1955
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 4.9E-10 1001 1143
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 4.6E-08 432 506

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 534 2118 0.0E+00
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 520 2127 0.0E+00
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 620 2119 0.0E+00
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 532 2118 0.0E+00
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 584 1535 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 534 2118 0.0E+00
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 520 2127 0.0E+00
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 620 2119 0.0E+00
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 532 2118 0.0E+00
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 584 1535 0.0E+00
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 620 2141 0.0E+00
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 620 1535 0.0E+00
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 611 2121 0.0E+00
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 30 1161 0.0E+00
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 478 1538 1.0E-177
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 596 1554 2.0E-173
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 620 2114 3.0E-173
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 620 2114 2.0E-172
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 620 2114 2.0E-172
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 28 1183 7.0E-162
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 620 1501 1.0E-153
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 620 1501 3.0E-153
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 620 1501 3.0E-153
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 547 1467 7.0E-150
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 547 1467 5.0E-149
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 547 1467 6.0E-149
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 617 1467 4.0E-142
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 617 1467 4.0E-142
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 620 1047 1.0E-141
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 622 1470 8.0E-135
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 622 1466 1.0E-134
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 622 1466 1.0E-134
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 622 1466 1.0E-134
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 622 1466 1.0E-134
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 622 1466 5.0E-134
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 49 1165 3.0E-124
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 620 1514 6.0E-122
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 620 1468 2.0E-120
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 618 1512 8.0E-120
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 614 1506 2.0E-119
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 618 1477 2.0E-119
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 599 1531 5.0E-119
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 614 1506 2.0E-118
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 620 1534 5.0E-118
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 618 1512 1.0E-117
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 5 603 2.0E-111
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 606 1531 2.0E-111
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 622 1534 3.0E-110
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 622 1563 1.0E-109
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 622 1563 1.0E-109
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 622 1563 1.0E-109
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 621 1512 2.0E-108
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 612 1531 5.0E-105
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 28 610 4.0E-103
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 26 608 1.0E-102
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 618 1554 7.0E-102
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 16 609 1.0E-101
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 618 1560 2.0E-101
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 28 602 2.0E-100
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 28 602 2.0E-100
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 544 1162 4.0E-99
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 622 1534 4.0E-99
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 610 1164 1.0E-98
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 26 605 1.0E-98
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 28 601 1.0E-98
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 28 598 3.0E-98
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 27 595 4.0E-98
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 28 611 9.0E-98
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 28 651 1.0E-97
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 15 630 1.0E-97
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 547 1160 2.0E-97
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 15 605 3.0E-97
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 28 651 5.0E-97
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 619 1534 9.0E-97
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 28 602 2.0E-96
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 547 1165 2.0E-96
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 26 598 4.0E-96
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 42 598 4.0E-96
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 604 1542 4.0E-96
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 28 591 1.0E-94
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 15 596 2.0E-94
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 618 1466 3.0E-94
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 547 1165 7.0E-94
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 619 1466 9.0E-94
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 26 601 1.0E-93
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 630 1545 2.0E-93
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 32 603 2.0E-93
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 605 1534 7.0E-93
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 28 601 9.0E-93
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 26 600 2.0E-92
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 28 598 2.0E-92
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 621 1500 3.0E-92
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 28 598 5.0E-92
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 30 594 6.0E-92
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 622 1534 6.0E-92
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 622 1195 7.0E-92
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 15 601 1.0E-91
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 620 1512 1.0E-91
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 27 595 2.0E-91
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 619 1512 2.0E-91
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 26 594 2.0E-91
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 27 598 4.0E-91
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 27 608 4.0E-91
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 31 604 4.0E-91
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 622 1466 7.0E-91
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 28 604 8.0E-91
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 622 1466 1.0E-90
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 27 568 3.0E-90
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 25 607 3.0E-90
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 27 605 7.0E-90
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 619 1512 8.0E-90
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 619 1535 9.0E-90
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 27 595 2.0E-89
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 33 595 3.0E-89
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 593 1466 5.0E-89
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 28 595 5.0E-89
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 557 1160 1.0E-88
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 621 1466 2.0E-88
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 32 606 2.0E-88
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 15 603 3.0E-88
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 619 1534 3.0E-88
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 617 1466 5.0E-88
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 28 610 9.0E-88
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 28 615 1.0E-87
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 26 618 1.0E-87
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 617 1466 2.0E-87
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 619 1166 5.0E-87
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 621 1466 5.0E-87
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 26 598 5.0E-87
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 32 605 1.0E-86
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 28 602 1.0E-86
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 32 596 3.0E-86
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 26 602 3.0E-86
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 28 568 5.0E-86
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 25 596 9.0E-86
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 21 606 9.0E-86
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 621 1466 9.0E-86
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 29 602 2.0E-85
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 621 1466 4.0E-85
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 557 1160 1.0E-84
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 622 1466 1.0E-84
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 31 595 2.0E-84
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 29 602 2.0E-84
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 26 602 2.0E-84
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 611 1466 2.0E-84
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 623 1466 2.0E-84
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 28 595 3.0E-84
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 29 595 8.0E-84
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 19 604 1.0E-83
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 15 596 1.0E-83
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 28 600 2.0E-83
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 28 598 2.0E-83
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 28 598 6.0E-83
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 15 603 7.0E-83
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 618 1532 7.0E-83
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 28 624 9.0E-83
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 621 1466 1.0E-82
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 51 607 2.0E-82
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 616 1466 2.0E-82
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 28 596 1.0E-81
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 27 610 2.0E-80
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 29 595 5.0E-79
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 28 602 7.0E-79
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 28 602 7.0E-78
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 615 1466 1.0E-77
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 620 1527 2.0E-76
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 28 610 2.0E-76
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 620 1575 6.0E-76
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 29 591 1.0E-74
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 28 609 1.0E-74
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 29 591 3.0E-74
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 29 612 3.0E-74
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 29 613 7.0E-74
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 29 617 1.0E-73
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 54 595 1.0E-73
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 30 608 1.0E-73
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 620 1040 7.0E-73
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 53 616 2.0E-72
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 53 616 2.0E-72
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 620 1048 1.0E-71
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 52 616 2.0E-71
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 29 595 5.0E-71
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 29 602 1.0E-70
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 620 989 1.0E-69
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 29 602 4.0E-69
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 557 1189 7.0E-69
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 41 599 5.0E-68
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 620 1125 8.0E-66
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 26 600 3.0E-65
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 620 1048 5.0E-65
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 479 1048 8.0E-64
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1100 1535 1.0E-63
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 26 615 2.0E-62
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 622 1049 5.0E-62
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1 600 2.0E-60
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 598 1179 2.0E-60
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 28 601 3.0E-59
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 530 1048 1.0E-58
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 45 602 2.0E-58
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 45 602 2.0E-58
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 31 591 4.0E-58
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 32 514 8.0E-58
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 44 598 9.0E-57
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 28 605 1.0E-56
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 54 603 3.0E-56
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 29 462 1.0E-55
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 619 1049 1.0E-55
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 28 603 3.0E-55
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 29 602 7.0E-55
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 17 598 1.0E-54
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 42 604 2.0E-54
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 42 604 3.0E-54
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 33 595 2.0E-53
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 27 568 7.0E-53
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 23 611 7.0E-53
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 53 531 2.0E-52
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 51 587 1.0E-51
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 53 593 2.0E-51
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 27 604 6.0E-51
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 27 604 7.0E-51
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 27 604 7.0E-51
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 51 598 2.0E-50
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 29 600 8.0E-50
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 30 596 8.0E-50
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 49 512 1.0E-49
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 28 562 1.0E-49
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 28 562 1.0E-49
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 2063 2449 2.0E-49
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 33 598 6.0E-49
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1762 2118 1.0E-48
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 26 660 1.0E-48
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 31 512 1.0E-48
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 31 512 1.0E-48
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 31 512 1.0E-48
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 27 602 1.0E-48
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 25 562 2.0E-48
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 51 512 2.0E-48
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 31 512 3.0E-48
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 32 512 3.0E-48
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1762 2118 5.0E-48
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 31 512 5.0E-48
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 31 512 5.0E-48
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 31 512 5.0E-48
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 31 512 5.0E-48
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 27 568 7.0E-48
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 33 512 9.0E-48
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 33 512 1.0E-47
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 33 512 1.0E-47
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 37 518 2.0E-47
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 18 568 2.0E-47
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 18 568 2.0E-47
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 28 568 3.0E-47
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 31 512 4.0E-47
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 31 512 4.0E-47
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 42 514 4.0E-47
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 31 512 5.0E-47
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 27 574 9.0E-47
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 31 512 1.0E-46
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1762 2118 2.0E-46
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 29 562 2.0E-46
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 29 589 2.0E-46
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 26 596 2.0E-46
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 28 605 3.0E-46
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 29 562 3.0E-46
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 28 573 3.0E-46
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 52 646 1.0E-45
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 29 596 5.0E-45
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 26 604 6.0E-45
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 50 512 2.0E-44
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 90 512 4.0E-44
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 77 572 7.0E-44
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 42 465 8.0E-44
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 48 512 2.0E-43
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 27 596 3.0E-43
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 54 512 7.0E-43
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2144 2505 8.0E-43
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 90 512 1.0E-42
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 90 512 1.0E-42
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 32 514 3.0E-42
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 90 512 6.0E-42
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 90 512 6.0E-42
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 29 568 9.0E-42
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1762 2119 1.0E-41
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 29 562 1.0E-41
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 52 512 2.0E-41
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 33 512 2.0E-41
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 32 514 2.0E-41
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 28 615 3.0E-41
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 33 512 3.0E-41
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 33 512 3.0E-41
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 33 512 3.0E-41
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 33 512 3.0E-41
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 33 512 5.0E-41
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 27 512 5.0E-41
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 27 512 5.0E-41
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 27 512 8.0E-41
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 48 512 9.0E-41
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 48 512 9.0E-41
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 48 512 9.0E-41
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 28 604 1.0E-40
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 48 512 1.0E-40
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 33 512 1.0E-40
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 45 459 1.0E-40
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 27 571 1.0E-40
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 48 512 1.0E-40
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 48 512 1.0E-40
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 48 512 1.0E-40
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 33 512 2.0E-40
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 33 512 2.0E-40
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 48 512 2.0E-40
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 48 512 2.0E-40
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 48 512 2.0E-40
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 48 512 2.0E-40
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 33 512 2.0E-40
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 28 599 2.0E-39
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1666 2105 3.0E-39
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 52 514 7.0E-39
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 52 514 7.0E-39
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 52 514 7.0E-39
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 52 514 7.0E-39
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 52 514 7.0E-39
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 52 514 7.0E-39
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 52 514 3.0E-38
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 52 514 3.0E-38
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 52 514 3.0E-38
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 52 514 3.0E-38
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 52 514 3.0E-38
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 52 514 3.0E-38
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 52 514 3.0E-38
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 52 514 6.0E-38
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 52 514 6.0E-38
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 33 575 7.0E-38
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 53 608 1.0E-37
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 33 568 5.0E-37
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 52 514 1.0E-36
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 26 595 1.0E-35
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 31 678 2.0E-35
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 29 514 9.0E-35
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 54 512 1.0E-34
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 51 512 2.0E-34
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 79 606 4.0E-34
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 22 512 1.0E-33
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1740 2141 1.0E-33
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1740 2141 1.0E-33
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 97 459 1.0E-33
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 29 573 6.0E-33
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1666 2118 6.0E-33
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1753 2117 6.0E-31
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1753 2117 6.0E-31
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1753 2117 6.0E-31
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1753 2117 6.0E-31
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1753 2117 6.0E-31
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 774 1043 7.0E-31
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2060 2398 9.0E-31
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1752 2118 2.0E-30
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 699 1049 5.0E-30
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 699 1051 5.0E-30
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1137 1550 8.0E-30
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2161 2437 8.0E-30
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2164 2398 9.0E-30
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1760 2110 1.0E-29
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 699 1043 1.0E-29
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 699 1049 1.0E-29
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 1182 1469 3.0E-29
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2164 2398 5.0E-29
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2150 2438 3.0E-28
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 26 512 7.0E-28
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 1183 1469 1.0E-27
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 774 1049 2.0E-27
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 774 1046 3.0E-27
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 1182 1476 3.0E-27
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 29 575 8.0E-27
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 1182 1469 2.0E-26
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 1182 1469 2.0E-26
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 1182 1469 2.0E-26
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1763 2445 2.0E-26
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 618 1006 3.0E-26
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 622 1048 3.0E-26
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 1182 1469 3.0E-26
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 1182 1469 3.0E-26
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 1182 1469 3.0E-26
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 1182 1469 3.0E-26
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 42 514 4.0E-26
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 702 1048 4.0E-26
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 774 1049 8.0E-26
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 622 1050 1.0E-25
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 25 512 1.0E-25
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 1182 1469 2.0E-25
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1760 2115 4.0E-25
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 24 621 5.0E-25
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 774 1047 5.0E-25
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 33 514 8.0E-25
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 1182 1469 9.0E-25
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 1182 1469 9.0E-25
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 774 1047 1.0E-24
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2153 2398 2.0E-24
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 1183 1469 2.0E-24
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 29 588 2.0E-24
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 692 1045 2.0E-24
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 692 1045 2.0E-24
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 692 1045 2.0E-24
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 32 510 3.0E-24
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 774 1047 3.0E-24
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 1182 1469 3.0E-24
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 24 512 4.0E-24
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1183 1466 6.0E-24
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 622 1006 8.0E-24
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 699 1049 9.0E-24
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 699 1049 1.0E-23
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 699 1049 1.0E-23
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 699 1049 1.0E-23
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 699 1048 1.0E-23
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 632 1006 1.0E-23
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1666 2118 2.0E-23
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1666 2118 2.0E-23
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1666 2118 2.0E-23
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1499 2133 2.0E-23
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 699 1049 2.0E-23
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 699 1049 2.0E-23
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 43 512 3.0E-23
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 1183 1469 3.0E-23
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 1183 1469 4.0E-23
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 622 1052 6.0E-23
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1565 2120 8.0E-23
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 21 512 1.0E-22
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 21 512 1.0E-22
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1181 1466 2.0E-22
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1643 2114 2.0E-22
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1845 2403 2.0E-22
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 24 512 2.0E-22
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 692 1045 2.0E-22
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 27 512 2.0E-22
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 1183 1509 3.0E-22
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 27 512 3.0E-22
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 50 512 4.0E-22
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 27 512 5.0E-22
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 21 512 5.0E-22
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 21 512 5.0E-22
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 21 512 5.0E-22
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 21 512 5.0E-22
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 720 1048 6.0E-22
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 42 514 6.0E-22
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 692 1049 6.0E-22
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 689 1048 9.0E-22
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 622 1030 9.0E-22
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 50 512 1.0E-21
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 24 512 1.0E-21
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 21 512 2.0E-21
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 21 512 2.0E-21
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 27 512 2.0E-21
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 24 512 2.0E-21
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 1183 1484 2.0E-21
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1791 2117 2.0E-21
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 50 512 3.0E-21
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 43 512 3.0E-21
sp|Q7MBA6|ACSA_PHOLL Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 27 512 4.0E-21
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 774 1049 4.0E-21
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1168 1504 4.0E-21
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 33 512 5.0E-21
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 42 512 6.0E-21
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 1182 1469 6.0E-21
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 713 1052 6.0E-21
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 49 514 1.0E-20
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 52 449 1.0E-20
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 52 449 1.0E-20
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 774 1048 1.0E-20
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 51 512 1.0E-20
sp|A4SJM6|ACSA_AERS4 Acetyl-coenzyme A synthetase OS=Aeromonas salmonicida (strain A449) GN=acsA PE=3 SV=1 21 512 2.0E-20
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 21 512 2.0E-20
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 51 512 2.0E-20
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 60 524 2.0E-20
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 768 1049 2.0E-20
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 768 1049 2.0E-20
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 768 1049 2.0E-20
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 768 1049 2.0E-20
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1758 2171 2.0E-20
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1845 2383 2.0E-20
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 50 512 4.0E-20
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 42 514 5.0E-20
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 27 512 7.0E-20
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 27 512 7.0E-20
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 50 512 7.0E-20
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1665 2123 7.0E-20
sp|Q12MK0|ACSA_SHEDO Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 27 512 8.0E-20
sp|E3UUE6|FAC19_RHORH 3-oxocholest-4-en-26-oate--CoA ligase OS=Rhodococcus rhodochrous GN=fadD19 PE=1 SV=1 32 518 8.0E-20
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1665 2123 8.0E-20
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1875 2400 8.0E-20
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 476 595 9.0E-20
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 40 512 9.0E-20
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1665 2123 9.0E-20
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1759 2126 9.0E-20
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 27 512 1.0E-19
sp|A9KY56|ACSA_SHEB9 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 27 512 1.0E-19
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 27 512 1.0E-19
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 27 512 1.0E-19
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 33 512 1.0E-19
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1758 2171 1.0E-19
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 1183 1466 2.0E-19
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 27 512 2.0E-19
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 41 512 2.0E-19
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1763 2403 2.0E-19
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 50 514 3.0E-19
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 32 512 3.0E-19
sp|Q88DW6|ACSA2_PSEPK Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain KT2440) GN=acsA2 PE=3 SV=1 27 512 3.0E-19
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 33 512 4.0E-19
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 27 512 5.0E-19
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 36 512 6.0E-19
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 27 512 6.0E-19
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 52 512 7.0E-19
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 763 1045 9.0E-19
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 51 512 9.0E-19
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 73 512 1.0E-18
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 29 516 1.0E-18
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 28 516 1.0E-18
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1765 2403 1.0E-18
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 692 1049 2.0E-18
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 27 512 2.0E-18
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 27 512 2.0E-18
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 51 512 2.0E-18
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1763 2403 2.0E-18
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 41 512 3.0E-18
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 27 512 3.0E-18
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 42 512 3.0E-18
sp|Q9KV59|ACSA_VIBCH Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 50 512 4.0E-18
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1499 2115 5.0E-18
sp|B0SRX5|ACSA_LEPBP Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acsA PE=3 SV=1 53 449 5.0E-18
sp|B0S8X7|ACSA_LEPBA Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acsA PE=3 SV=1 53 449 5.0E-18
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 27 512 5.0E-18
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 32 512 5.0E-18
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 52 512 5.0E-18
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 54 512 7.0E-18
sp|Q2LW77|ACSA_SYNAS Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) GN=acsA PE=3 SV=1 49 512 8.0E-18
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 763 1046 8.0E-18
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 50 514 1.0E-17
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 31 516 1.0E-17
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 31 516 1.0E-17
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 27 512 1.0E-17
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 42 512 1.0E-17
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 32 512 1.0E-17
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 53 512 1.0E-17
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 26 517 1.0E-17
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 54 512 2.0E-17
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 52 512 2.0E-17
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 28 516 2.0E-17
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 42 512 2.0E-17
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 53 512 2.0E-17
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 51 512 2.0E-17
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1910 2399 2.0E-17
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 27 528 3.0E-17
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 2147 2467 3.0E-17
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 54 512 3.0E-17
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 781 1042 3.0E-17
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 781 1042 3.0E-17
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 781 1042 3.0E-17
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 781 1042 3.0E-17
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 42 512 4.0E-17
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 73 512 4.0E-17
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 50 514 5.0E-17
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 50 514 5.0E-17
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1760 2115 5.0E-17
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 54 512 6.0E-17
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 32 512 7.0E-17
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 757 1049 7.0E-17
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1751 2383 7.0E-17
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 42 512 8.0E-17
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 26 512 8.0E-17
sp|Q72J95|ACSA_THET2 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=acsA PE=3 SV=1 50 535 8.0E-17
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1860 2378 8.0E-17
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 42 512 9.0E-17
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 42 512 1.0E-16
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 769 1042 1.0E-16
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 50 514 2.0E-16
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 32 514 2.0E-16
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 32 516 2.0E-16
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 42 512 2.0E-16
sp|Q5SIW6|ACSA_THET8 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acsA PE=3 SV=1 50 535 2.0E-16
sp|A1S7C8|ACSA_SHEAM Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 50 512 2.0E-16
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 52 512 3.0E-16
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 52 512 3.0E-16
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 42 512 3.0E-16
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 54 512 3.0E-16
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 53 512 4.0E-16
sp|A3QD52|ACSA_SHELP Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 50 512 4.0E-16
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 26 576 4.0E-16
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 26 576 4.0E-16
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 26 576 4.0E-16
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 32 516 4.0E-16
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 32 516 4.0E-16
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 29 512 4.0E-16
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 42 512 5.0E-16
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 27 449 5.0E-16
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 42 512 6.0E-16
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 42 512 6.0E-16
sp|A8FUF1|ACSA_SHESH Acetyl-coenzyme A synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=acsA PE=3 SV=1 27 512 6.0E-16
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 51 514 7.0E-16
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 27 512 8.0E-16
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 51 512 8.0E-16
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 53 512 8.0E-16
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 54 512 9.0E-16
sp|Q1H0J2|ACSA_METFK Acetyl-coenzyme A synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acsA PE=3 SV=1 27 512 9.0E-16
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 53 512 1.0E-15
sp|A1W1D6|ACSA_CAMJJ Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acsA PE=3 SV=1 54 512 1.0E-15
sp|Q9PMD2|ACSA_CAMJE Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acsA PE=3 SV=1 54 512 1.0E-15
sp|A6VZN8|ACSA_MARMS Acetyl-coenzyme A synthetase OS=Marinomonas sp. (strain MWYL1) GN=acsA PE=3 SV=1 27 512 1.0E-15
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 27 512 1.0E-15
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 27 512 1.0E-15
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 27 512 1.0E-15
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 27 512 1.0E-15
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 27 512 1.0E-15
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 27 512 1.0E-15
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 27 512 1.0E-15
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 27 512 1.0E-15
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 50 512 1.0E-15
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 52 512 1.0E-15
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 51 512 2.0E-15
sp|P28812|Y3568_PSEAE Uncharacterized protein PA3568 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3568 PE=3 SV=2 44 458 2.0E-15
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 52 512 2.0E-15
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 27 512 2.0E-15
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 51 516 2.0E-15
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 53 512 2.0E-15
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 42 512 2.0E-15
sp|A8FNJ7|ACSA_CAMJ8 Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 54 512 2.0E-15
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 53 512 2.0E-15
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 53 512 2.0E-15
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 42 512 3.0E-15
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 2130 2399 3.0E-15
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 42 512 3.0E-15
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1756 2123 4.0E-15
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 51 512 4.0E-15
sp|Q2T3N9|ACSA_BURTA Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 27 528 5.0E-15
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 53 512 5.0E-15
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 622 1052 5.0E-15
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 50 512 5.0E-15
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 50 512 5.0E-15
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 51 512 5.0E-15
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 50 512 6.0E-15
sp|Q87KU7|ACSA_VIBPA Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 50 512 6.0E-15
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 22 512 7.0E-15
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 781 1046 7.0E-15
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 50 512 7.0E-15
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 32 510 8.0E-15
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 32 510 8.0E-15
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 32 510 8.0E-15
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 53 512 8.0E-15
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 50 512 8.0E-15
sp|B1ZB59|ACSA_METPB Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 27 512 9.0E-15
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 53 512 9.0E-15
sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acsA PE=3 SV=1 51 512 1.0E-14
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 36 512 1.0E-14
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 720 1049 1.0E-14
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 26 459 1.0E-14
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 26 512 1.0E-14
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1808 1949 2.0E-14
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 42 512 2.0E-14
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 42 512 2.0E-14
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 33 512 2.0E-14
sp|Q8K9J6|FABD_BUCAP Malonyl CoA-acyl carrier protein transacylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabD PE=3 SV=1 1184 1469 2.0E-14
sp|A7HSR8|ACSA_PARL1 Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 27 512 2.0E-14
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 1 449 2.0E-14
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 42 514 3.0E-14
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 54 512 3.0E-14
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 21 512 3.0E-14
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1753 2110 2.0E-12
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1869 2399 3.0E-11
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2164 2408 4.0E-11
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1787 2133 1.0E-09
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1761 1949 2.0E-09
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1737 1948 5.0E-09
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1174 1527 7.0E-09
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1737 1948 9.0E-09
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 480 598 2.0E-08
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1805 1976 4.0E-08
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1667 1976 4.0E-08
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1787 2112 5.0E-08
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1787 1950 2.0E-07
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2162 2328 4.0E-07
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1787 1956 2.0E-06
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1170 1527 4.0E-06
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1787 1956 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0003824 catalytic activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0048037 cofactor binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2029
MEIVSGEDVLVGGKEFCGIDESAMLGHCVHRLLEHSAKRHWERTAVICLERKLTYRQVHMLANHLARVLASRGVR
RGDLVAVAVERSANVVIALLAVLKAGAAFVPMDPTFPARRISQMMEDAAPSLVVASASTIAVFSAWQDVCLLVDE
ALKDDDINGETLQVETRPEDLVFIMYTSGSTGRPKGVEMGHGALANLLLSLQREPGCDETDRMLAVSTISFDMAF
LEIFLPLLCGAAVVMTEAQQTRDPRALVGLMKRHAITMMQATPAAWQMLLDSGWSGEPRLRSMLSTAEALPRRLA
ERLLDCGDELWNVYGPTETEIATVWKVRRGEEIVVGGAICNSRLYVLDDNMAPVALGSAGELYIGGAGVARGYRN
NAELTRSRFLDDPFHPGGRVYRTGDLARFVAPNKLSILGRMDAQIKVRGYRIEPGDVEAAITDHKSVSGAVVIGR
DKRLIAYIVRDRTRDKGPDGPLHTVLRPWLTERLPAYMMPCLFIELEALPLTPNGKVDRRALPDPAGVSRESRVV
ELPTSELEHRILAIWTQVLGHEDISVDDSFFEVGGDSARLIQVQQELEKLLNQILSTVELFEHFTIGKLAAHLTS
ARTNGLKGTPRKRQGGASDEDIAIVSTACRLPGGVETPEQFWDLLQKGADVIKHVPSDRWSADALYDADPDARGK
SYCCTGGFLDSATCNSFDAHFFGISPREARALDPIQWIVLETCWEAFERAGYTSNQLRGSQTGVFIGTSNIAAYE
RVASGDAAGLDGYAATGTAAATLSGRVSYILGLEGPAMTVDTACSSSLVAIHLACSALRLGECDVAVSCGASLVL
NPGLYIEFSRLRGVSPDGRCRAFAADAQGTGWGEGSAAIVLKRLSDAQRDGDAIHAVIRGTAMNHDGRSAGLTVP
SGTSQQRLIRTCLSVAGLQPQDIDYIEAHGTGTKLGDPIEAAALADVFGHCRSEAHLPLYVGSAKSNLGHTQAAA
GLVGLLKVILALQHESLPQTLHVSEPTPAVDWKCARMALVLEKQPWACKAHRPRRAGVSAFGIGGTNAHVVVQEA
PRLINGDMEAPRRLNGDDGLPGDRNGVDDGTEAMNRDENATLLPASLPFLLSGVSDASLRAQAEKLRKYIEAKRP
GSLGDIAYSLATSRNHFRRRLAVLAGNQAELLEKLAAVAQSPTLAAKDQTIATSAPKIAMLFTGQGSQRLGMGKQ
LSAVYPVFRDAIAEITAHFSNLERPLLNVMWAEAGSSDAAFLSRTDFAQPALFALEVALWRLWQSWGVCPDLVLG
HSVGEIAAAHVAGVMDLDDACRLVAARGQLMQALPTSCGGAMASLEAGADEIAAAVKTLGLDAQLGIAGYNTPTQ
TVVSGDGPAVQQVIHYLLARGQRRHKRLDVSHAFHSHHMESILAPLSKVAESLSLRPPKLAIISSLSGRMAEPGQ
LSQASYWAQQARQAVRFCDGMQALASHGANVFVEVGPHPVLCGMGAACLGDASSKAWLPSLAAGKDEALVVQTSL
ADLHIRHVDLDWLAYFGPFGCRRVELPTYAFQRERVRPDNKLALWAPGLTSVDGAGSTASKSDFEIAWHPAATDH
AQPSGKWGLLLVAQDAAWEAEITTALSRASGIQLVPVERLEDAQHLDGLLCLWESDANLDSATDVVFRAHDYTMR
GLTQLQTAASMPFAPPLVWVTRNAVSVGAHDGASGLGAAPLWGLMRTGRNELAELRLRLLDVGQDSAPAALVSAL
MLSAEPECAVRQKQVLVPRLQCLEQASPAKRPLLRTDGAVLITGGVGGLGSQVARRLASAHGVCDLVLISRHGMA
APGAQDLLTELSGLGAKATVVAGDVAHFNSIKSIITTMFGPQRPLRGVVHAAGVSGAGIVSHLTSQQCRVVLAPK
VDGSWNLHQLTRDMDLDLFAMFSSIASAWGMPGLANYSAANAFLDALASLRHAQHVPATSVAFGTWAGGGMASRM
AATTETHLANFGVDVLQPGDGLDSLEQAIRSRRALTVAAMVDSKRLARYFTTQGGIPPFYRSFLGELQVEEKPLF
DKDLRSKIAHAAPEQQAHLLLRVVRETVAQELGFSRPDLVDVDLPLQELGIDSLTAVLTRNHLAARTGLALTTNV
ILLQPSLRALGQALLHQLIRDEVGDALPQHSAPRLDVAAVLRGCLDADLCFDNSAASMPGRPESVLVTGATGFIG
AFIVHELLQKGIVAHCLVRANSHDEGRCRLETTLEDYGLWRPDYASLLQPVVGDITQPLLGLSEAAFNALADGVD
AICHSGALVDWMRPLNDYIGPNVISTHEVLRLASRGRAKALHLVSTIATLPLHRGFASVEDGPEYGYGTSKYIAE
RLVSAARWRGARASIYRLPLVTASAATGHFRLRRGDFLHMLLAGSLELGVFPSLDANLSAVLPVDYLSETITAMM
TRDLRRIGRDFDFANPRAPPFNQFAALMGAVKVLPFSVWHQRVLDYAAAHPEAPLARITAVLDGYSDQTAPTMVQ
GYPGGEHILGGQDDYPAPPVDEQTVLRYRDRITVASLA*
Coding >OphauB2|2029
ATGGAGATAGTTTCAGGTGAAGATGTTCTGGTAGGGGGCAAGGAGTTCTGCGGGATAGATGAGAGCGCTATGCTG
GGACACTGCGTGCACCGGCTCCTGGAGCACTCGGCAAAACGCCATTGGGAGCGCACAGCAGTCATCTGCCTCGAG
AGGAAGTTGACGTACCGACAAGTCCACATGCTCGCGAATCATCTAGCACGTGTCTTGGCTAGTCGAGGAGTCCGA
CGTGGTGATCTAGTGGCCGTGGCTGTGGAGCGATCGGCCAATGTTGTGATAGCACTGCTAGCGGTGCTCAAGGCG
GGTGCTGCCTTTGTGCCCATGGACCCGACCTTTCCTGCGAGACGGATAAGTCAGATGATGGAGGATGCGGCTCCA
AGCCTTGTCGTTGCCAGCGCCAGCACAATTGCAGTCTTTTCCGCGTGGCAAGACGTCTGCTTGCTAGTCGACGAG
GCACTCAAGGATGACGACATAAACGGCGAGACACTGCAGGTAGAAACACGGCCTGAAGATCTAGTCTTCATCATG
TACACATCAGGCTCGACTGGCCGGCCCAAGGGGGTGGAGATGGGTCACGGTGCTCTGGCAAACCTCCTGCTCTCG
CTGCAACGGGAGCCTGGCTGTGACGAGACGGATCGAATGCTGGCCGTCAGCACCATCTCTTTTGACATGGCCTTT
CTCGAGATCTTCCTCCCGCTGCTCTGCGGAGCGGCCGTGGTCATGACGGAGGCACAGCAAACAAGAGACCCAAGA
GCTCTCGTGGGCCTCATGAAGCGCCATGCCATCACCATGATGCAAGCGACGCCAGCCGCCTGGCAGATGCTGCTC
GACTCGGGCTGGAGCGGAGAGCCTCGGCTCCGCAGCATGCTCAGCACCGCTGAAGCGCTTCCCCGGCGGCTGGCC
GAACGCCTACTCGACTGCGGCGACGAGCTATGGAACGTCTATGGGCCCACCGAGACTGAGATTGCCACTGTATGG
AAGGTGCGTCGGGGTGAAGAAATCGTCGTCGGCGGGGCCATCTGCAATAGTCGGCTCTATGTGCTTGATGACAAC
ATGGCACCGGTTGCGCTCGGCAGCGCTGGAGAGCTCTACATTGGAGGCGCCGGGGTGGCTCGCGGCTATCGCAAC
AATGCTGAGCTGACACGGTCTCGCTTCCTCGACGACCCTTTTCACCCAGGGGGCCGCGTCTATCGAACCGGGGAT
CTGGCCCGCTTCGTCGCGCCCAACAAGCTAAGCATTCTCGGCCGCATGGATGCTCAAATCAAGGTCCGCGGCTAT
CGAATTGAGCCGGGTGACGTGGAAGCAGCTATTACGGACCACAAGTCTGTCTCTGGGGCCGTTGTAATCGGCCGG
GACAAGCGACTGATTGCTTACATTGTGCGAGACAGGACGCGAGACAAGGGGCCAGATGGACCGCTCCATACCGTG
CTTCGCCCTTGGCTGACAGAGCGACTACCTGCGTATATGATGCCTTGCCTGTTTATCGAGCTGGAAGCGCTTCCC
CTGACTCCCAATGGCAAGGTGGACCGAAGAGCGCTTCCCGATCCAGCGGGTGTGAGCCGAGAGTCGAGAGTCGTG
GAGCTGCCCACGTCTGAGCTGGAGCATAGAATACTAGCCATTTGGACGCAAGTCCTCGGCCATGAGGACATCTCG
GTTGACGATAGCTTCTTCGAGGTGGGAGGCGACTCTGCGCGTCTAATACAGGTTCAGCAAGAGCTAGAGAAGCTC
CTGAACCAGATTCTATCGACAGTTGAACTCTTTGAACATTTCACCATAGGAAAACTAGCTGCACACTTGACCTCG
GCGCGCACGAATGGTTTGAAAGGTACCCCTCGGAAAAGACAAGGCGGCGCAAGCGACGAGGATATTGCCATTGTC
TCCACTGCCTGCCGCCTCCCAGGTGGCGTTGAGACGCCAGAGCAATTCTGGGACTTGCTGCAAAAGGGTGCCGAT
GTCATCAAGCATGTGCCGTCGGATCGCTGGAGTGCAGATGCCCTATACGATGCCGACCCAGACGCTCGCGGCAAG
TCGTATTGCTGCACGGGCGGCTTCCTCGACTCGGCTACATGCAACTCGTTTGACGCTCACTTTTTTGGCATCTCG
CCGCGCGAGGCACGGGCTCTGGACCCCATCCAGTGGATAGTGCTGGAGACGTGCTGGGAAGCATTTGAGCGTGCG
GGCTACACCAGCAACCAGCTACGCGGCAGCCAGACAGGCGTCTTTATCGGCACGAGCAACATTGCGGCCTATGAG
CGTGTCGCTTCCGGCGATGCTGCTGGGCTGGATGGATACGCCGCCACGGGCACGGCGGCCGCGACTTTATCCGGA
CGCGTCTCGTATATCCTAGGCCTAGAGGGGCCTGCCATGACTGTAGATACAGCGTGCTCGTCGTCGCTAGTTGCA
ATTCACCTGGCCTGTAGCGCGCTGCGACTGGGAGAATGCGACGTGGCCGTATCGTGTGGAGCGAGCCTGGTGCTG
AATCCTGGCCTTTATATCGAATTCAGCCGCCTCCGAGGCGTCTCGCCAGACGGCCGTTGTCGAGCATTCGCAGCC
GATGCCCAGGGCACGGGCTGGGGCGAGGGCTCAGCGGCCATTGTCCTTAAGCGGCTTTCCGACGCTCAGCGTGAC
GGTGATGCCATTCACGCCGTGATACGCGGCACCGCCATGAATCACGATGGCCGCAGTGCCGGCCTCACAGTACCC
AGCGGCACCTCTCAGCAGCGACTAATCCGCACGTGCCTATCTGTGGCAGGGCTACAACCTCAAGACATTGATTAT
ATCGAGGCCCATGGAACAGGGACCAAGCTCGGTGATCCCATTGAAGCCGCAGCTCTAGCAGACGTCTTTGGACAC
TGCCGCTCCGAGGCGCATCTGCCGCTCTATGTCGGCTCGGCAAAGTCTAACCTGGGACATACCCAAGCGGCCGCG
GGCCTGGTGGGCTTGCTAAAGGTCATCTTGGCTCTGCAGCACGAGTCGCTGCCACAGACGCTGCACGTTTCTGAG
CCAACACCAGCAGTGGACTGGAAGTGCGCCCGCATGGCACTGGTCCTGGAGAAGCAACCGTGGGCATGCAAGGCC
CATCGCCCGCGTCGGGCTGGTGTCAGCGCCTTTGGTATTGGCGGGACAAATGCCCACGTGGTTGTCCAAGAGGCT
CCAAGGCTCATTAATGGAGACATGGAGGCGCCGAGACGCTTGAATGGAGACGATGGCTTGCCGGGGGATAGGAAT
GGAGTTGATGATGGGACAGAGGCGATGAATCGAGACGAGAATGCCACATTGTTGCCAGCCAGTCTTCCGTTCCTT
CTATCAGGCGTCTCAGACGCCAGCCTGCGCGCCCAAGCCGAAAAGCTGCGCAAATACATAGAAGCTAAACGCCCT
GGAAGCCTTGGTGACATTGCCTATTCCCTGGCCACTTCGCGCAACCACTTTCGCAGGCGACTAGCAGTCTTGGCT
GGGAACCAGGCGGAACTGCTGGAGAAGCTGGCTGCCGTTGCTCAGTCGCCCACCTTGGCCGCCAAGGACCAGACA
ATAGCGACGTCTGCACCCAAGATAGCCATGCTCTTCACCGGGCAGGGCAGCCAGCGGCTGGGAATGGGCAAGCAG
CTGAGTGCCGTCTACCCCGTCTTCCGGGACGCAATCGCCGAAATCACGGCGCACTTTAGCAATCTGGAGCGGCCG
CTCCTCAACGTCATGTGGGCTGAAGCTGGCAGCTCGGATGCCGCCTTTTTAAGCCGGACCGACTTTGCCCAGCCT
GCCCTTTTTGCACTCGAGGTGGCGCTTTGGCGGCTGTGGCAAAGCTGGGGCGTTTGTCCAGACCTTGTGCTCGGC
CACAGCGTGGGCGAAATCGCAGCGGCGCATGTGGCCGGCGTCATGGACCTTGACGACGCCTGCCGGCTGGTGGCG
GCTCGCGGACAGCTGATGCAAGCACTGCCGACGAGTTGCGGCGGTGCCATGGCGTCGCTTGAAGCCGGGGCCGAC
GAGATTGCCGCGGCTGTTAAAACTCTGGGCCTCGATGCTCAGCTCGGCATCGCGGGCTACAACACGCCAACGCAG
ACTGTCGTGTCGGGGGATGGCCCGGCCGTGCAACAAGTAATACATTACCTGCTCGCACGGGGGCAACGGCGGCAT
AAGAGGCTAGACGTGTCGCACGCCTTCCACTCACACCACATGGAGAGCATATTGGCGCCCCTTAGCAAGGTGGCT
GAGAGCCTGTCGTTGCGTCCACCCAAGCTCGCCATTATCAGTAGTCTTAGTGGCAGAATGGCCGAGCCCGGGCAG
CTCAGCCAGGCCTCCTACTGGGCCCAGCAGGCACGACAAGCCGTGCGCTTCTGCGACGGCATGCAAGCCCTGGCC
AGCCATGGCGCCAACGTCTTTGTCGAAGTAGGCCCGCACCCGGTCCTTTGTGGCATGGGAGCGGCCTGCCTTGGC
GATGCAAGCTCCAAAGCCTGGCTGCCATCGCTTGCTGCCGGCAAAGACGAGGCCTTGGTCGTCCAGACAAGTCTT
GCCGACTTGCACATTCGTCATGTCGACCTTGACTGGCTGGCTTACTTTGGGCCCTTTGGCTGCCGCCGCGTAGAG
CTGCCAACCTATGCTTTCCAGCGAGAGCGTGTTCGGCCCGACAACAAGCTCGCCCTATGGGCACCGGGGCTCACG
AGTGTGGACGGAGCTGGTAGCACGGCGTCAAAATCAGACTTTGAGATTGCCTGGCATCCAGCTGCGACGGACCAT
GCGCAGCCCAGTGGGAAATGGGGCCTCCTCCTGGTTGCCCAAGACGCTGCCTGGGAAGCAGAAATAACCACGGCC
CTGTCGCGGGCTAGTGGCATCCAGCTTGTGCCTGTGGAGCGCCTCGAGGACGCGCAGCACCTCGACGGGCTGCTG
TGCTTATGGGAGTCTGATGCAAACTTGGACTCGGCAACAGACGTGGTGTTCCGGGCGCACGACTACACCATGCGC
GGCTTGACACAGCTGCAGACAGCAGCAAGCATGCCCTTTGCGCCGCCATTGGTCTGGGTTACCCGCAACGCGGTT
AGTGTCGGCGCCCATGACGGCGCTTCCGGCCTGGGAGCGGCCCCGCTGTGGGGCCTGATGCGCACCGGCCGGAAC
GAGCTTGCGGAGCTCCGTCTGCGCCTGCTTGATGTCGGCCAGGACTCGGCCCCGGCTGCCCTTGTCTCGGCCCTG
ATGCTGAGCGCCGAACCGGAATGCGCCGTGCGTCAGAAGCAGGTGCTCGTGCCGCGTCTGCAATGCCTAGAGCAG
GCGTCGCCAGCCAAACGCCCGCTCCTCCGAACAGACGGCGCAGTGCTCATCACTGGCGGCGTCGGCGGCCTTGGA
TCGCAAGTTGCCCGTCGGCTGGCCAGCGCCCACGGAGTCTGCGACTTGGTTCTCATCTCGAGGCACGGCATGGCG
GCTCCGGGTGCCCAGGACTTGCTAACGGAGCTGTCGGGGCTTGGCGCCAAAGCTACCGTTGTGGCTGGCGATGTA
GCCCATTTCAATAGCATCAAGTCCATCATTACCACAATGTTTGGCCCCCAGAGACCCTTGCGCGGTGTCGTGCAC
GCAGCCGGTGTCTCTGGCGCTGGCATTGTGTCGCACTTGACGTCTCAGCAGTGTCGTGTGGTGCTTGCTCCCAAG
GTTGATGGCTCCTGGAACCTACACCAACTTACTCGAGACATGGACCTAGACTTGTTTGCCATGTTCTCCTCGATT
GCTAGCGCCTGGGGCATGCCCGGTCTGGCCAACTATTCCGCTGCCAATGCCTTCCTCGATGCACTCGCGAGCCTC
CGCCATGCCCAGCATGTCCCGGCTACCTCGGTGGCCTTTGGCACCTGGGCGGGCGGCGGCATGGCATCCCGCATG
GCCGCAACAACCGAGACCCATCTTGCCAACTTTGGCGTCGACGTGCTCCAACCAGGAGACGGGCTGGACAGCCTG
GAACAGGCCATACGTAGCCGTCGCGCCCTCACTGTAGCCGCCATGGTTGACTCGAAGCGGCTGGCAAGATACTTC
ACCACCCAGGGCGGTATTCCCCCCTTTTATCGCTCCTTTCTCGGAGAGCTTCAAGTCGAGGAGAAGCCCCTTTTT
GACAAGGATCTACGCTCCAAGATTGCTCACGCAGCACCCGAGCAGCAGGCGCATTTGCTTCTGCGTGTGGTGCGC
GAAACAGTGGCCCAGGAACTAGGATTCTCACGTCCGGACCTTGTCGACGTGGACCTGCCCTTGCAAGAGCTAGGC
ATCGACTCTCTTACTGCAGTGCTCACGCGTAACCACCTGGCGGCGCGGACCGGCCTCGCGCTGACCACCAATGTG
ATTCTTCTTCAGCCGAGCTTGAGAGCTCTTGGCCAGGCACTGCTGCACCAGCTTATACGAGATGAAGTTGGTGAT
GCGCTTCCCCAGCACTCGGCTCCTCGCCTCGACGTGGCGGCCGTCCTCAGGGGCTGTCTCGATGCCGACCTCTGC
TTCGACAATTCCGCGGCCTCTATGCCTGGCCGCCCCGAGTCTGTCTTGGTGACGGGCGCCACGGGCTTCATTGGT
GCCTTTATCGTGCATGAGCTGCTGCAAAAGGGCATCGTCGCTCACTGTCTGGTGCGCGCCAACAGCCACGACGAG
GGCCGTTGCCGACTAGAGACGACTCTTGAGGACTATGGCCTCTGGAGACCTGATTACGCGTCGCTTCTTCAGCCC
GTCGTCGGCGACATCACACAGCCTTTGCTGGGCTTGAGCGAGGCCGCCTTTAACGCTCTTGCTGACGGCGTTGAT
GCCATTTGCCACTCGGGTGCCCTGGTTGATTGGATGCGTCCGCTAAACGACTACATTGGACCCAACGTGATAAGC
ACGCACGAAGTCTTGCGCCTAGCCTCTCGTGGCCGCGCCAAAGCACTTCACCTCGTATCCACCATTGCTACCCTG
CCCTTGCACCGAGGCTTTGCTTCTGTGGAAGACGGTCCCGAGTATGGCTATGGCACTTCCAAGTACATTGCCGAG
CGACTGGTATCGGCCGCTCGGTGGCGCGGGGCCCGGGCCTCCATCTATCGGCTGCCTCTAGTCACCGCCTCAGCT
GCAACGGGCCACTTTCGCCTCCGCCGCGGCGACTTTTTGCACATGCTGCTCGCGGGCAGTCTCGAGCTCGGCGTC
TTTCCCTCACTTGACGCCAACCTATCGGCAGTCTTGCCCGTCGACTACCTGAGCGAGACTATTACCGCCATGATG
ACGCGAGACCTGCGTCGCATCGGTAGGGACTTTGACTTTGCCAACCCGCGCGCACCGCCATTTAACCAGTTTGCC
GCGCTCATGGGAGCCGTCAAAGTCCTTCCCTTTAGCGTCTGGCACCAGCGAGTCCTTGACTATGCTGCAGCTCAT
CCAGAGGCGCCCCTGGCCCGCATCACTGCCGTTCTCGACGGCTACTCGGACCAGACGGCGCCCACCATGGTCCAG
GGCTACCCTGGCGGAGAGCACATCTTGGGCGGACAAGACGACTATCCCGCGCCGCCTGTCGACGAGCAGACTGTC
CTCAGGTATCGGGACCGCATCACTGTCGCATCACTGGCCTAG
Transcript >OphauB2|2029
ATGGAGATAGTTTCAGGTGAAGATGTTCTGGTAGGGGGCAAGGAGTTCTGCGGGATAGATGAGAGCGCTATGCTG
GGACACTGCGTGCACCGGCTCCTGGAGCACTCGGCAAAACGCCATTGGGAGCGCACAGCAGTCATCTGCCTCGAG
AGGAAGTTGACGTACCGACAAGTCCACATGCTCGCGAATCATCTAGCACGTGTCTTGGCTAGTCGAGGAGTCCGA
CGTGGTGATCTAGTGGCCGTGGCTGTGGAGCGATCGGCCAATGTTGTGATAGCACTGCTAGCGGTGCTCAAGGCG
GGTGCTGCCTTTGTGCCCATGGACCCGACCTTTCCTGCGAGACGGATAAGTCAGATGATGGAGGATGCGGCTCCA
AGCCTTGTCGTTGCCAGCGCCAGCACAATTGCAGTCTTTTCCGCGTGGCAAGACGTCTGCTTGCTAGTCGACGAG
GCACTCAAGGATGACGACATAAACGGCGAGACACTGCAGGTAGAAACACGGCCTGAAGATCTAGTCTTCATCATG
TACACATCAGGCTCGACTGGCCGGCCCAAGGGGGTGGAGATGGGTCACGGTGCTCTGGCAAACCTCCTGCTCTCG
CTGCAACGGGAGCCTGGCTGTGACGAGACGGATCGAATGCTGGCCGTCAGCACCATCTCTTTTGACATGGCCTTT
CTCGAGATCTTCCTCCCGCTGCTCTGCGGAGCGGCCGTGGTCATGACGGAGGCACAGCAAACAAGAGACCCAAGA
GCTCTCGTGGGCCTCATGAAGCGCCATGCCATCACCATGATGCAAGCGACGCCAGCCGCCTGGCAGATGCTGCTC
GACTCGGGCTGGAGCGGAGAGCCTCGGCTCCGCAGCATGCTCAGCACCGCTGAAGCGCTTCCCCGGCGGCTGGCC
GAACGCCTACTCGACTGCGGCGACGAGCTATGGAACGTCTATGGGCCCACCGAGACTGAGATTGCCACTGTATGG
AAGGTGCGTCGGGGTGAAGAAATCGTCGTCGGCGGGGCCATCTGCAATAGTCGGCTCTATGTGCTTGATGACAAC
ATGGCACCGGTTGCGCTCGGCAGCGCTGGAGAGCTCTACATTGGAGGCGCCGGGGTGGCTCGCGGCTATCGCAAC
AATGCTGAGCTGACACGGTCTCGCTTCCTCGACGACCCTTTTCACCCAGGGGGCCGCGTCTATCGAACCGGGGAT
CTGGCCCGCTTCGTCGCGCCCAACAAGCTAAGCATTCTCGGCCGCATGGATGCTCAAATCAAGGTCCGCGGCTAT
CGAATTGAGCCGGGTGACGTGGAAGCAGCTATTACGGACCACAAGTCTGTCTCTGGGGCCGTTGTAATCGGCCGG
GACAAGCGACTGATTGCTTACATTGTGCGAGACAGGACGCGAGACAAGGGGCCAGATGGACCGCTCCATACCGTG
CTTCGCCCTTGGCTGACAGAGCGACTACCTGCGTATATGATGCCTTGCCTGTTTATCGAGCTGGAAGCGCTTCCC
CTGACTCCCAATGGCAAGGTGGACCGAAGAGCGCTTCCCGATCCAGCGGGTGTGAGCCGAGAGTCGAGAGTCGTG
GAGCTGCCCACGTCTGAGCTGGAGCATAGAATACTAGCCATTTGGACGCAAGTCCTCGGCCATGAGGACATCTCG
GTTGACGATAGCTTCTTCGAGGTGGGAGGCGACTCTGCGCGTCTAATACAGGTTCAGCAAGAGCTAGAGAAGCTC
CTGAACCAGATTCTATCGACAGTTGAACTCTTTGAACATTTCACCATAGGAAAACTAGCTGCACACTTGACCTCG
GCGCGCACGAATGGTTTGAAAGGTACCCCTCGGAAAAGACAAGGCGGCGCAAGCGACGAGGATATTGCCATTGTC
TCCACTGCCTGCCGCCTCCCAGGTGGCGTTGAGACGCCAGAGCAATTCTGGGACTTGCTGCAAAAGGGTGCCGAT
GTCATCAAGCATGTGCCGTCGGATCGCTGGAGTGCAGATGCCCTATACGATGCCGACCCAGACGCTCGCGGCAAG
TCGTATTGCTGCACGGGCGGCTTCCTCGACTCGGCTACATGCAACTCGTTTGACGCTCACTTTTTTGGCATCTCG
CCGCGCGAGGCACGGGCTCTGGACCCCATCCAGTGGATAGTGCTGGAGACGTGCTGGGAAGCATTTGAGCGTGCG
GGCTACACCAGCAACCAGCTACGCGGCAGCCAGACAGGCGTCTTTATCGGCACGAGCAACATTGCGGCCTATGAG
CGTGTCGCTTCCGGCGATGCTGCTGGGCTGGATGGATACGCCGCCACGGGCACGGCGGCCGCGACTTTATCCGGA
CGCGTCTCGTATATCCTAGGCCTAGAGGGGCCTGCCATGACTGTAGATACAGCGTGCTCGTCGTCGCTAGTTGCA
ATTCACCTGGCCTGTAGCGCGCTGCGACTGGGAGAATGCGACGTGGCCGTATCGTGTGGAGCGAGCCTGGTGCTG
AATCCTGGCCTTTATATCGAATTCAGCCGCCTCCGAGGCGTCTCGCCAGACGGCCGTTGTCGAGCATTCGCAGCC
GATGCCCAGGGCACGGGCTGGGGCGAGGGCTCAGCGGCCATTGTCCTTAAGCGGCTTTCCGACGCTCAGCGTGAC
GGTGATGCCATTCACGCCGTGATACGCGGCACCGCCATGAATCACGATGGCCGCAGTGCCGGCCTCACAGTACCC
AGCGGCACCTCTCAGCAGCGACTAATCCGCACGTGCCTATCTGTGGCAGGGCTACAACCTCAAGACATTGATTAT
ATCGAGGCCCATGGAACAGGGACCAAGCTCGGTGATCCCATTGAAGCCGCAGCTCTAGCAGACGTCTTTGGACAC
TGCCGCTCCGAGGCGCATCTGCCGCTCTATGTCGGCTCGGCAAAGTCTAACCTGGGACATACCCAAGCGGCCGCG
GGCCTGGTGGGCTTGCTAAAGGTCATCTTGGCTCTGCAGCACGAGTCGCTGCCACAGACGCTGCACGTTTCTGAG
CCAACACCAGCAGTGGACTGGAAGTGCGCCCGCATGGCACTGGTCCTGGAGAAGCAACCGTGGGCATGCAAGGCC
CATCGCCCGCGTCGGGCTGGTGTCAGCGCCTTTGGTATTGGCGGGACAAATGCCCACGTGGTTGTCCAAGAGGCT
CCAAGGCTCATTAATGGAGACATGGAGGCGCCGAGACGCTTGAATGGAGACGATGGCTTGCCGGGGGATAGGAAT
GGAGTTGATGATGGGACAGAGGCGATGAATCGAGACGAGAATGCCACATTGTTGCCAGCCAGTCTTCCGTTCCTT
CTATCAGGCGTCTCAGACGCCAGCCTGCGCGCCCAAGCCGAAAAGCTGCGCAAATACATAGAAGCTAAACGCCCT
GGAAGCCTTGGTGACATTGCCTATTCCCTGGCCACTTCGCGCAACCACTTTCGCAGGCGACTAGCAGTCTTGGCT
GGGAACCAGGCGGAACTGCTGGAGAAGCTGGCTGCCGTTGCTCAGTCGCCCACCTTGGCCGCCAAGGACCAGACA
ATAGCGACGTCTGCACCCAAGATAGCCATGCTCTTCACCGGGCAGGGCAGCCAGCGGCTGGGAATGGGCAAGCAG
CTGAGTGCCGTCTACCCCGTCTTCCGGGACGCAATCGCCGAAATCACGGCGCACTTTAGCAATCTGGAGCGGCCG
CTCCTCAACGTCATGTGGGCTGAAGCTGGCAGCTCGGATGCCGCCTTTTTAAGCCGGACCGACTTTGCCCAGCCT
GCCCTTTTTGCACTCGAGGTGGCGCTTTGGCGGCTGTGGCAAAGCTGGGGCGTTTGTCCAGACCTTGTGCTCGGC
CACAGCGTGGGCGAAATCGCAGCGGCGCATGTGGCCGGCGTCATGGACCTTGACGACGCCTGCCGGCTGGTGGCG
GCTCGCGGACAGCTGATGCAAGCACTGCCGACGAGTTGCGGCGGTGCCATGGCGTCGCTTGAAGCCGGGGCCGAC
GAGATTGCCGCGGCTGTTAAAACTCTGGGCCTCGATGCTCAGCTCGGCATCGCGGGCTACAACACGCCAACGCAG
ACTGTCGTGTCGGGGGATGGCCCGGCCGTGCAACAAGTAATACATTACCTGCTCGCACGGGGGCAACGGCGGCAT
AAGAGGCTAGACGTGTCGCACGCCTTCCACTCACACCACATGGAGAGCATATTGGCGCCCCTTAGCAAGGTGGCT
GAGAGCCTGTCGTTGCGTCCACCCAAGCTCGCCATTATCAGTAGTCTTAGTGGCAGAATGGCCGAGCCCGGGCAG
CTCAGCCAGGCCTCCTACTGGGCCCAGCAGGCACGACAAGCCGTGCGCTTCTGCGACGGCATGCAAGCCCTGGCC
AGCCATGGCGCCAACGTCTTTGTCGAAGTAGGCCCGCACCCGGTCCTTTGTGGCATGGGAGCGGCCTGCCTTGGC
GATGCAAGCTCCAAAGCCTGGCTGCCATCGCTTGCTGCCGGCAAAGACGAGGCCTTGGTCGTCCAGACAAGTCTT
GCCGACTTGCACATTCGTCATGTCGACCTTGACTGGCTGGCTTACTTTGGGCCCTTTGGCTGCCGCCGCGTAGAG
CTGCCAACCTATGCTTTCCAGCGAGAGCGTGTTCGGCCCGACAACAAGCTCGCCCTATGGGCACCGGGGCTCACG
AGTGTGGACGGAGCTGGTAGCACGGCGTCAAAATCAGACTTTGAGATTGCCTGGCATCCAGCTGCGACGGACCAT
GCGCAGCCCAGTGGGAAATGGGGCCTCCTCCTGGTTGCCCAAGACGCTGCCTGGGAAGCAGAAATAACCACGGCC
CTGTCGCGGGCTAGTGGCATCCAGCTTGTGCCTGTGGAGCGCCTCGAGGACGCGCAGCACCTCGACGGGCTGCTG
TGCTTATGGGAGTCTGATGCAAACTTGGACTCGGCAACAGACGTGGTGTTCCGGGCGCACGACTACACCATGCGC
GGCTTGACACAGCTGCAGACAGCAGCAAGCATGCCCTTTGCGCCGCCATTGGTCTGGGTTACCCGCAACGCGGTT
AGTGTCGGCGCCCATGACGGCGCTTCCGGCCTGGGAGCGGCCCCGCTGTGGGGCCTGATGCGCACCGGCCGGAAC
GAGCTTGCGGAGCTCCGTCTGCGCCTGCTTGATGTCGGCCAGGACTCGGCCCCGGCTGCCCTTGTCTCGGCCCTG
ATGCTGAGCGCCGAACCGGAATGCGCCGTGCGTCAGAAGCAGGTGCTCGTGCCGCGTCTGCAATGCCTAGAGCAG
GCGTCGCCAGCCAAACGCCCGCTCCTCCGAACAGACGGCGCAGTGCTCATCACTGGCGGCGTCGGCGGCCTTGGA
TCGCAAGTTGCCCGTCGGCTGGCCAGCGCCCACGGAGTCTGCGACTTGGTTCTCATCTCGAGGCACGGCATGGCG
GCTCCGGGTGCCCAGGACTTGCTAACGGAGCTGTCGGGGCTTGGCGCCAAAGCTACCGTTGTGGCTGGCGATGTA
GCCCATTTCAATAGCATCAAGTCCATCATTACCACAATGTTTGGCCCCCAGAGACCCTTGCGCGGTGTCGTGCAC
GCAGCCGGTGTCTCTGGCGCTGGCATTGTGTCGCACTTGACGTCTCAGCAGTGTCGTGTGGTGCTTGCTCCCAAG
GTTGATGGCTCCTGGAACCTACACCAACTTACTCGAGACATGGACCTAGACTTGTTTGCCATGTTCTCCTCGATT
GCTAGCGCCTGGGGCATGCCCGGTCTGGCCAACTATTCCGCTGCCAATGCCTTCCTCGATGCACTCGCGAGCCTC
CGCCATGCCCAGCATGTCCCGGCTACCTCGGTGGCCTTTGGCACCTGGGCGGGCGGCGGCATGGCATCCCGCATG
GCCGCAACAACCGAGACCCATCTTGCCAACTTTGGCGTCGACGTGCTCCAACCAGGAGACGGGCTGGACAGCCTG
GAACAGGCCATACGTAGCCGTCGCGCCCTCACTGTAGCCGCCATGGTTGACTCGAAGCGGCTGGCAAGATACTTC
ACCACCCAGGGCGGTATTCCCCCCTTTTATCGCTCCTTTCTCGGAGAGCTTCAAGTCGAGGAGAAGCCCCTTTTT
GACAAGGATCTACGCTCCAAGATTGCTCACGCAGCACCCGAGCAGCAGGCGCATTTGCTTCTGCGTGTGGTGCGC
GAAACAGTGGCCCAGGAACTAGGATTCTCACGTCCGGACCTTGTCGACGTGGACCTGCCCTTGCAAGAGCTAGGC
ATCGACTCTCTTACTGCAGTGCTCACGCGTAACCACCTGGCGGCGCGGACCGGCCTCGCGCTGACCACCAATGTG
ATTCTTCTTCAGCCGAGCTTGAGAGCTCTTGGCCAGGCACTGCTGCACCAGCTTATACGAGATGAAGTTGGTGAT
GCGCTTCCCCAGCACTCGGCTCCTCGCCTCGACGTGGCGGCCGTCCTCAGGGGCTGTCTCGATGCCGACCTCTGC
TTCGACAATTCCGCGGCCTCTATGCCTGGCCGCCCCGAGTCTGTCTTGGTGACGGGCGCCACGGGCTTCATTGGT
GCCTTTATCGTGCATGAGCTGCTGCAAAAGGGCATCGTCGCTCACTGTCTGGTGCGCGCCAACAGCCACGACGAG
GGCCGTTGCCGACTAGAGACGACTCTTGAGGACTATGGCCTCTGGAGACCTGATTACGCGTCGCTTCTTCAGCCC
GTCGTCGGCGACATCACACAGCCTTTGCTGGGCTTGAGCGAGGCCGCCTTTAACGCTCTTGCTGACGGCGTTGAT
GCCATTTGCCACTCGGGTGCCCTGGTTGATTGGATGCGTCCGCTAAACGACTACATTGGACCCAACGTGATAAGC
ACGCACGAAGTCTTGCGCCTAGCCTCTCGTGGCCGCGCCAAAGCACTTCACCTCGTATCCACCATTGCTACCCTG
CCCTTGCACCGAGGCTTTGCTTCTGTGGAAGACGGTCCCGAGTATGGCTATGGCACTTCCAAGTACATTGCCGAG
CGACTGGTATCGGCCGCTCGGTGGCGCGGGGCCCGGGCCTCCATCTATCGGCTGCCTCTAGTCACCGCCTCAGCT
GCAACGGGCCACTTTCGCCTCCGCCGCGGCGACTTTTTGCACATGCTGCTCGCGGGCAGTCTCGAGCTCGGCGTC
TTTCCCTCACTTGACGCCAACCTATCGGCAGTCTTGCCCGTCGACTACCTGAGCGAGACTATTACCGCCATGATG
ACGCGAGACCTGCGTCGCATCGGTAGGGACTTTGACTTTGCCAACCCGCGCGCACCGCCATTTAACCAGTTTGCC
GCGCTCATGGGAGCCGTCAAAGTCCTTCCCTTTAGCGTCTGGCACCAGCGAGTCCTTGACTATGCTGCAGCTCAT
CCAGAGGCGCCCCTGGCCCGCATCACTGCCGTTCTCGACGGCTACTCGGACCAGACGGCGCCCACCATGGTCCAG
GGCTACCCTGGCGGAGAGCACATCTTGGGCGGACAAGACGACTATCCCGCGCCGCCTGTCGACGAGCAGACTGTC
CTCAGGTATCGGGACCGCATCACTGTCGCATCACTGGCCTAG
Gene >OphauB2|2029
ATGGAGATAGTTTCAGGTGAAGATGTTCTGGTAGGGGGCAAGGAGTTCTGCGGGATAGATGAGAGCGCTATGCTG
GGACACTGCGTGCACCGGCTCCTGGAGCACTCGGCAAAACGCCATTGGGAGCGCACAGCAGTCATCTGCCTCGAG
AGGAAGTTGACGTACCGACAAGTCCACATGCTCGCGAATCATCTAGCACGTGTCTTGGCTAGTCGAGGAGTCCGA
CGTGGTGATCTAGTGGCCGTGGCTGTGGAGCGATCGGCCAATGTTGTGATAGCACTGCTAGCGGTGCTCAAGGCG
GGTGCTGCCTTTGTGCCCATGGACCCGACCTTTCCTGCGAGACGGATAAGTCAGATGATGGAGGATGCGGCTCCA
AGCCTTGTCGTTGCCAGCGCCAGCACAATTGCAGTCTTTTCCGCGTGGCAAGACGTCTGCTTGCTAGTCGACGAG
GCACTCAAGGATGACGACATAAACGGCGAGACACTGCAGGTAGAAACACGGCCTGAAGATCTAGTCTTCATCATG
TACACATCAGGCTCGACTGGCCGGCCCAAGGGGGTGGAGATGGGTCACGGTGCTCTGGCAAACCTCCTGCTCTCG
CTGCAACGGGAGCCTGGCTGTGACGAGACGGATCGAATGCTGGCCGTCAGCACCATCTCTTTTGACATGGCCTTT
CTCGAGATCTTCCTCCCGCTGCTCTGCGGAGCGGCCGTGGTCATGACGGAGGCACAGCAAACAAGAGACCCAAGA
GCTCTCGTGGGCCTCATGAAGCGCCATGCCATCACCATGATGCAAGCGACGCCAGCCGCCTGGCAGATGCTGCTC
GACTCGGGCTGGAGCGGAGAGCCTCGGCTCCGCAGCATGCTCAGCACCGCTGAAGCGCTTCCCCGGCGGCTGGCC
GAACGCCTACTCGACTGCGGCGACGAGCTATGGAACGTCTATGGGCCCACCGAGACTGAGATTGCCACTGTATGG
AAGGTGCGTCGGGGTGAAGAAATCGTCGTCGGCGGGGCCATCTGCAATAGTCGGCTCTATGTGCTTGATGACAAC
ATGGCACCGGTTGCGCTCGGCAGCGCTGGAGAGCTCTACATTGGAGGCGCCGGGGTGGCTCGCGGCTATCGCAAC
AATGCTGAGCTGACACGGTCTCGCTTCCTCGACGACCCTTTTCACCCAGGGGGCCGCGTCTATCGAACCGGGGAT
CTGGCCCGCTTCGTCGCGCCCAACAAGCTAAGCATTCTCGGCCGCATGGATGCTCAAATCAAGGTCCGCGGCTAT
CGAATTGAGCCGGGTGACGTGGAAGCAGCTATTACGGACCACAAGTCTGTCTCTGGGGCCGTTGTAATCGGCCGG
GACAAGCGACTGATTGCTTACATTGTGCGAGACAGGACGCGAGACAAGGGGCCAGATGGACCGCTCCATACCGTG
CTTCGCCCTTGGCTGACAGAGCGACTACCTGCGTATATGATGCCTTGCCTGTTTATCGAGCTGGAAGCGCTTCCC
CTGACTCCCAATGGCAAGGTGGACCGAAGAGCGCTTCCCGATCCAGCGGGTGTGAGCCGAGAGTCGAGAGTCGTG
GAGCTGCCCACGTCTGAGCTGGAGCATAGAATACTAGCCATTTGGACGCAAGTCCTCGGCCATGAGGACATCTCG
GTTGACGATAGCTTCTTCGAGGTGGGAGGCGACTCTGCGCGTCTAATACAGGTTCAGCAAGAGCTAGAGAAGCTC
CTGAACCAGATTCTATCGACAGTTGAACTCTTTGAACATTTCACCATAGGAAAACTAGCTGCACACTTGACCTCG
GCGCGCACGAATGGTTTGAAAGGTACCCCTCGGAAAAGACAAGGCGGCGCAAGCGACGAGGATATTGCCATTGTC
TCCACTGCCTGCCGCCTCCCAGGTGGCGTTGAGACGCCAGAGCAATTCTGGGACTTGCTGCAAAAGGGTGCCGAT
GTCATCAAGCATGTGCCGTCGGATCGCTGGAGTGCAGATGCCCTATACGATGCCGACCCAGACGCTCGCGGCAAG
TCGTATTGCTGCACGGGCGGCTTCCTCGACTCGGCTACATGCAACTCGTTTGACGCTCACTTTTTTGGCATCTCG
CCGCGCGAGGCACGGGCTCTGGACCCCATCCAGTGGATAGTGCTGGAGACGTGCTGGGAAGCATTTGAGCGTGCG
GGCTACACCAGCAACCAGCTACGCGGCAGCCAGACAGGCGTCTTTATCGGCACGAGCAACATTGCGGCCTATGAG
CGTGTCGCTTCCGGCGATGCTGCTGGGCTGGATGGATACGCCGCCACGGGCACGGCGGCCGCGACTTTATCCGGA
CGCGTCTCGTATATCCTAGGCCTAGAGGGGCCTGCCATGACTGTAGATACAGCGTGCTCGTCGTCGCTAGTTGCA
ATTCACCTGGCCTGTAGCGCGCTGCGACTGGGAGAATGCGACGTGGCCGTATCGTGTGGAGCGAGCCTGGTGCTG
AATCCTGGCCTTTATATCGAATTCAGCCGCCTCCGAGGCGTCTCGCCAGACGGCCGTTGTCGAGCATTCGCAGCC
GATGCCCAGGGCACGGGCTGGGGCGAGGGCTCAGCGGCCATTGTCCTTAAGCGGCTTTCCGACGCTCAGCGTGAC
GGTGATGCCATTCACGCCGTGATACGCGGCACCGCCATGAATCACGATGGCCGCAGTGCCGGCCTCACAGTACCC
AGCGGCACCTCTCAGCAGCGACTAATCCGCACGTGCCTATCTGTGGCAGGGCTACAACCTCAAGACATTGATTAT
ATCGAGGCCCATGGAACAGGGACCAAGCTCGGTGATCCCATTGAAGCCGCAGCTCTAGCAGACGTCTTTGGACAC
TGCCGCTCCGAGGCGCATCTGCCGCTCTATGTCGGCTCGGCAAAGTCTAACCTGGGACATACCCAAGCGGCCGCG
GGCCTGGTGGGCTTGCTAAAGGTCATCTTGGCTCTGCAGCACGAGTCGCTGCCACAGACGCTGCACGTTTCTGAG
CCAACACCAGCAGTGGACTGGAAGTGCGCCCGCATGGCACTGGTCCTGGAGAAGCAACCGTGGGCATGCAAGGCC
CATCGCCCGCGTCGGGCTGGTGTCAGCGCCTTTGGTATTGGCGGGACAAATGCCCACGTGGTTGTCCAAGAGGCT
CCAAGGCTCATTAATGGAGACATGGAGGCGCCGAGACGCTTGAATGGAGACGATGGCTTGCCGGGGGATAGGAAT
GGAGTTGATGATGGGACAGAGGCGATGAATCGAGACGAGAATGCCACATTGTTGCCAGCCAGTCTTCCGTTCCTT
CTATCAGGCGTCTCAGACGCCAGCCTGCGCGCCCAAGCCGAAAAGCTGCGCAAATACATAGAAGCTAAACGCCCT
GGAAGCCTTGGTGACATTGCCTATTCCCTGGCCACTTCGCGCAACCACTTTCGCAGGCGACTAGCAGTCTTGGCT
GGGAACCAGGCGGAACTGCTGGAGAAGCTGGCTGCCGTTGCTCAGTCGCCCACCTTGGCCGCCAAGGACCAGACA
ATAGCGACGTCTGCACCCAAGATAGCCATGCTCTTCACCGGGCAGGGCAGCCAGCGGCTGGGAATGGGCAAGCAG
CTGAGTGCCGTCTACCCCGTCTTCCGGGACGCAATCGCCGAAATCACGGCGCACTTTAGCAATCTGGAGCGGCCG
CTCCTCAACGTCATGTGGGCTGAAGCTGGCAGCTCGGATGCCGCCTTTTTAAGCCGGACCGACTTTGCCCAGCCT
GCCCTTTTTGCACTCGAGGTGGCGCTTTGGCGGCTGTGGCAAAGCTGGGGCGTTTGTCCAGACCTTGTGCTCGGC
CACAGCGTGGGCGAAATCGCAGCGGCGCATGTGGCCGGCGTCATGGACCTTGACGACGCCTGCCGGCTGGTGGCG
GCTCGCGGACAGCTGATGCAAGCACTGCCGACGAGTTGCGGCGGTGCCATGGCGTCGCTTGAAGCCGGGGCCGAC
GAGATTGCCGCGGCTGTTAAAACTCTGGGCCTCGATGCTCAGCTCGGCATCGCGGGCTACAACACGCCAACGCAG
ACTGTCGTGTCGGGGGATGGCCCGGCCGTGCAACAAGTAATACATTACCTGCTCGCACGGGGGCAACGGCGGCAT
AAGAGGCTAGACGTGTCGCACGCCTTCCACTCACACCACATGGAGAGCATATTGGCGCCCCTTAGCAAGGTGGCT
GAGAGCCTGTCGTTGCGTCCACCCAAGCTCGCCATTATCAGTAGTCTTAGTGGCAGAATGGCCGAGCCCGGGCAG
CTCAGCCAGGCCTCCTACTGGGCCCAGCAGGCACGACAAGCCGTGCGCTTCTGCGACGGCATGCAAGCCCTGGCC
AGCCATGGCGCCAACGTCTTTGTCGAAGTAGGCCCGCACCCGGTCCTTTGTGGCATGGGAGCGGCCTGCCTTGGC
GATGCAAGCTCCAAAGCCTGGCTGCCATCGCTTGCTGCCGGCAAAGACGAGGCCTTGGTCGTCCAGACAAGTCTT
GCCGACTTGCACATTCGTCATGTCGACCTTGACTGGCTGGCTTACTTTGGGCCCTTTGGCTGCCGCCGCGTAGAG
CTGCCAACCTATGCTTTCCAGCGAGAGCGTGTTCGGCCCGACAACAAGCTCGCCCTATGGGCACCGGGGCTCACG
AGTGTGGACGGAGCTGGTAGCACGGCGTCAAAATCAGACTTTGAGATTGCCTGGCATCCAGCTGCGACGGACCAT
GCGCAGCCCAGTGGGAAATGGGGCCTCCTCCTGGTTGCCCAAGACGCTGCCTGGGAAGCAGAAATAACCACGGCC
CTGTCGCGGGCTAGTGGCATCCAGCTTGTGCCTGTGGAGCGCCTCGAGGACGCGCAGCACCTCGACGGGCTGCTG
TGCTTATGGGAGTCTGATGCAAACTTGGACTCGGCAACAGACGTGGTGTTCCGGGCGCACGACTACACCATGCGC
GGCTTGACACAGCTGCAGACAGCAGCAAGCATGCCCTTTGCGCCGCCATTGGTCTGGGTTACCCGCAACGCGGTT
AGTGTCGGCGCCCATGACGGCGCTTCCGGCCTGGGAGCGGCCCCGCTGTGGGGCCTGATGCGCACCGGCCGGAAC
GAGCTTGCGGAGCTCCGTCTGCGCCTGCTTGATGTCGGCCAGGACTCGGCCCCGGCTGCCCTTGTCTCGGCCCTG
ATGCTGAGCGCCGAACCGGAATGCGCCGTGCGTCAGAAGCAGGTGCTCGTGCCGCGTCTGCAATGCCTAGAGCAG
GCGTCGCCAGCCAAACGCCCGCTCCTCCGAACAGACGGCGCAGTGCTCATCACTGGCGGCGTCGGCGGCCTTGGA
TCGCAAGTTGCCCGTCGGCTGGCCAGCGCCCACGGAGTCTGCGACTTGGTTCTCATCTCGAGGCACGGCATGGCG
GCTCCGGGTGCCCAGGACTTGCTAACGGAGCTGTCGGGGCTTGGCGCCAAAGCTACCGTTGTGGCTGGCGATGTA
GCCCATTTCAATAGCATCAAGTCCATCATTACCACAATGTTTGGCCCCCAGAGACCCTTGCGCGGTGTCGTGCAC
GCAGCCGGTGTCTCTGGCGCTGGCATTGTGTCGCACTTGACGTCTCAGCAGTGTCGTGTGGTGCTTGCTCCCAAG
GTTGATGGCTCCTGGAACCTACACCAACTTACTCGAGACATGGACCTAGACTTGTTTGCCATGTTCTCCTCGATT
GCTAGCGCCTGGGGCATGCCCGGTCTGGCCAACTATTCCGCTGCCAATGCCTTCCTCGATGCACTCGCGAGCCTC
CGCCATGCCCAGCATGTCCCGGCTACCTCGGTGGCCTTTGGCACCTGGGCGGGCGGCGGCATGGCATCCCGCATG
GCCGCAACAACCGAGACCCATCTTGCCAACTTTGGCGTCGACGTGCTCCAACCAGGAGACGGGCTGGACAGCCTG
GAACAGGCCATACGTAGCCGTCGCGCCCTCACTGTAGCCGCCATGGTTGACTCGAAGCGGCTGGCAAGATACTTC
ACCACCCAGGGCGGTATTCCCCCCTTTTATCGCTCCTTTCTCGGAGAGCTTCAAGTCGAGGAGAAGCCCCTTTTT
GACAAGGATCTACGCTCCAAGATTGCTCACGCAGCACCCGAGCAGCAGGCGCATTTGCTTCTGCGTGTGGTGCGC
GAAACAGTGGCCCAGGAACTAGGATTCTCACGTCCGGACCTTGTCGACGTGGACCTGCCCTTGCAAGAGCTAGGC
ATCGACTCTCTTACTGCAGTGCTCACGCGTAACCACCTGGCGGCGCGGACCGGCCTCGCGCTGACCACCAATGTG
ATTCTTCTTCAGCCGAGCTTGAGAGCTCTTGGCCAGGCACTGCTGCACCAGCTTATACGAGATGAAGTTGGTGAT
GCGCTTCCCCAGCACTCGGCTCCTCGCCTCGACGTGGCGGCCGTCCTCAGGGGCTGTCTCGATGCCGACCTCTGC
TTCGACAATTCCGCGGCCTCTATGCCTGGCCGCCCCGAGTCTGTCTTGGTGACGGGCGCCACGGGCTTCATTGGT
GCCTTTATCGTGCATGAGCTGCTGCAAAAGGGCATCGTCGCTCACTGTCTGGTGCGCGCCAACAGCCACGACGAG
GGCCGTTGCCGACTAGAGACGACTCTTGAGGACTATGGCCTCTGGAGACCTGATTACGCGTCGCTTCTTCAGCCC
GTCGTCGGCGACATCACACAGCCTTTGCTGGGCTTGAGCGAGGCCGCCTTTAACGCTCTTGCTGACGGCGTTGAT
GCCATTTGCCACTCGGGTGCCCTGGTTGATTGGATGCGTCCGCTAAACGACTACATTGGACCCAACGTGATAAGC
ACGCACGAAGTCTTGCGCCTAGCCTCTCGTGGCCGCGCCAAAGCACTTCACCTCGTATCCACCATTGCTACCCTG
CCCTTGCACCGAGGCTTTGCTTCTGTGGAAGACGGTCCCGAGTATGGCTATGGCACTTCCAAGTACATTGCCGAG
CGACTGGTATCGGCCGCTCGGTGGCGCGGGGCCCGGGCCTCCATCTATCGGCTGCCTCTAGTCACCGCCTCAGCT
GCAACGGGCCACTTTCGCCTCCGCCGCGGCGACTTTTTGCACATGCTGCTCGCGGGCAGTCTCGAGCTCGGCGTC
TTTCCCTCACTTGACGCCAACCTATCGGCAGTCTTGCCCGTCGACTACCTGAGCGAGACTATTACCGCCATGATG
ACGCGAGACCTGCGTCGCATCGGTAGGGACTTTGACTTTGCCAACCCGCGCGCACCGCCATTTAACCAGTTTGCC
GCGCTCATGGGAGCCGTCAAAGTCCTTCCCTTTAGCGTCTGGCACCAGCGAGTCCTTGACTATGCTGCAGCTCAT
CCAGAGGCGCCCCTGGCCCGCATCACTGCCGTTCTCGACGGCTACTCGGACCAGACGGCGCCCACCATGGTCCAG
GGCTACCCTGGCGGAGAGCACATCTTGGGCGGACAAGACGACTATCCCGCGCCGCCTGTCGACGAGCAGACTGTC
CTCAGGTATCGGGACCGCATCACTGTCGCATCACTGGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail