Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2027
Gene name
LocationContig_16:145014..161136
Strand-
Gene length (bp)16122
Transcript length (bp)16065
Coding sequence length (bp)16065
Protein length (aa) 5355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.2E-70 606 994
PF00501 AMP-binding AMP-binding enzyme 5.1E-73 1687 2071
PF00501 AMP-binding AMP-binding enzyme 1.4E-71 2765 3167
PF00501 AMP-binding AMP-binding enzyme 1.3E-75 3826 4225
PF00501 AMP-binding AMP-binding enzyme 4.4E-71 4913 5307
PF00668 Condensation Condensation domain 2.2E-42 164 564
PF00668 Condensation Condensation domain 4.6E-40 1244 1648
PF00668 Condensation Condensation domain 8.4E-44 2328 2726
PF00668 Condensation Condensation domain 5.1E-40 3397 3783
PF00668 Condensation Condensation domain 2.6E-41 4471 4889
PF00550 PP-binding Phosphopantetheine attachment site 5.5E-10 58 119
PF00550 PP-binding Phosphopantetheine attachment site 5.6E-10 1136 1194
PF00550 PP-binding Phosphopantetheine attachment site 7.7E-08 2215 2275
PF00550 PP-binding Phosphopantetheine attachment site 7.3E-09 3294 3353
PF00550 PP-binding Phosphopantetheine attachment site 1.4E-09 4365 4425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1700 4776 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1660 4774 0.0E+00
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 567 3346 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 163 2565 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 163 2729 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1700 4776 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1660 4774 0.0E+00
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 567 3346 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 163 2565 0.0E+00
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 163 2729 0.0E+00
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 159 2081 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 161 3690 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1240 4775 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2325 5345 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1 2628 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 163 3352 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1240 4425 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2323 5330 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 2469 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3371 5350 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2761 4545 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 593 2388 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3817 5354 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1673 3343 0.0E+00
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1 5350 0.0E+00
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 157 5332 0.0E+00
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1 4424 0.0E+00
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 163 4441 0.0E+00
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1 3386 0.0E+00
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2327 5322 0.0E+00
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2419 5317 0.0E+00
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 163 4441 0.0E+00
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2327 5322 0.0E+00
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1 3386 0.0E+00
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2419 5317 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 608 2725 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2761 4772 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1674 3782 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 3823 5317 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1 1642 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 328 2314 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3758 5341 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2694 4545 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1379 3451 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1 1301 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 608 2718 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2761 4772 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1674 3782 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 3823 5317 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1 1574 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 608 2718 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2761 4772 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1674 3782 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 3823 5317 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1 1574 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 516 2455 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1606 3358 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2694 4423 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3755 5348 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1 1287 0.0E+00
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 159 3591 0.0E+00
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1238 4424 0.0E+00
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2327 5350 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 597 4768 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1674 5350 0.0E+00
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1 3644 0.0E+00
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 157 3353 0.0E+00
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1236 4425 0.0E+00
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2327 5352 0.0E+00
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 163 3351 0.0E+00
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1238 4431 0.0E+00
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2327 5349 0.0E+00
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 272 3573 0.0E+00
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1277 4431 0.0E+00
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2403 5349 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 163 2471 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1242 3559 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2327 4610 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 148 2278 0.0E+00
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 489 3343 0.0E+00
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1625 4415 0.0E+00
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2675 5316 0.0E+00
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 564 3351 0.0E+00
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1646 4423 0.0E+00
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 480 3343 0.0E+00
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1646 4415 0.0E+00
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 480 3343 0.0E+00
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1646 4415 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 163 2276 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 163 2606 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1236 3354 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2327 4424 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2327 4754 0.0E+00
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 162 2737 3.0E-180
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 163 2493 6.0E-179
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2327 4760 2.0E-178
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3389 5317 3.0E-177
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 163 2759 9.0E-177
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1 2604 3.0E-176
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1727 3708 4.0E-176
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1616 4613 1.0E-175
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2694 5350 5.0E-175
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3395 5349 6.0E-175
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1 2494 8.0E-175
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1242 3827 1.0E-174
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3395 5330 2.0E-174
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 163 2606 9.0E-174
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1226 3352 4.0E-172
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1 2646 4.0E-171
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1227 3559 1.0E-169
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1 2472 2.0E-169
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1 2375 3.0E-169
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1242 3355 2.0E-168
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 311 2605 2.0E-168
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3395 5317 3.0E-168
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1238 3627 6.0E-168
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1 1564 7.0E-168
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2439 4646 9.0E-168
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2768 4795 7.0E-167
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3393 5317 1.0E-166
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2323 4795 2.0E-166
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 149 1560 3.0E-166
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2324 4754 3.0E-166
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3399 5317 8.0E-166
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3398 5322 1.0E-165
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2673 5327 5.0E-165
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 158 2719 7.0E-165
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2673 5327 1.0E-164
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1655 2781 3.0E-164
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1 2635 1.0E-162
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 163 2641 4.0E-161
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3748 4894 2.0E-160
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2327 4443 7.0E-160
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2761 5349 1.0E-159
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3395 5354 1.0E-159
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3395 5354 1.0E-159
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2327 4435 3.0E-158
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1209 3177 7.0E-158
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2758 5350 1.0E-157
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2327 4425 1.0E-157
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 575 1668 3.0E-157
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2326 4427 6.0E-156
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3382 4754 7.0E-155
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2327 4440 1.0E-154
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2474 4757 2.0E-154
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1240 2625 2.0E-154
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 186 2604 4.0E-154
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3337 5317 2.0E-152
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3397 5317 2.0E-151
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1 2623 2.0E-150
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 163 1560 3.0E-150
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3392 5354 4.0E-150
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2325 4235 1.0E-149
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1666 3651 1.0E-149
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2740 3842 1.0E-149
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2326 3731 3.0E-149
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1214 2621 7.0E-149
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2327 3779 2.0E-148
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 3395 5325 6.0E-147
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2350 4727 1.0E-146
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 3826 5317 3.0E-146
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 1384 1.0E-143
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1662 3570 1.0E-142
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3397 5317 2.0E-140
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1 2386 2.0E-139
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 3787 5323 3.0E-139
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 3389 5317 4.0E-139
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 3399 5317 3.0E-137
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3395 4774 9.0E-136
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 237 2282 1.0E-132
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1 2588 2.0E-132
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1 2459 5.0E-132
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1 2459 1.0E-131
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2416 4416 5.0E-131
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1670 2646 2.0E-128
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1332 3567 3.0E-128
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 617 2595 9.0E-128
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 239 2292 2.0E-127
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2755 4424 1.0E-125
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 3817 5316 2.0E-125
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2736 4432 5.0E-125
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 3757 5350 1.0E-120
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1 1556 5.0E-119
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2757 3707 4.0E-118
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 594 1561 4.0E-117
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1239 2265 2.0E-116
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1608 2623 3.0E-116
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 4467 5354 9.0E-116
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 4465 5317 2.0E-115
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3805 5317 6.0E-115
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1 1636 8.0E-115
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 3748 4774 8.0E-114
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 566 1632 5.0E-113
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 376 1197 4.0E-112
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1453 2297 4.0E-112
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2689 3689 5.0E-112
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 3818 4797 7.0E-112
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4471 5322 5.0E-111
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 3473 5349 2.0E-110
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4686 5328 2.0E-109
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3794 5332 2.0E-109
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3794 5332 4.0E-109
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 4463 5324 2.0E-107
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3604 4441 2.0E-107
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 3468 5317 3.0E-106
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1 1459 1.0E-105
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1214 2601 8.0E-105
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1696 3333 2.0E-104
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 3967 5348 2.0E-104
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1242 2291 2.0E-103
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2780 4527 3.0E-103
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 592 2615 2.0E-101
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1 1641 2.0E-100
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2538 3370 5.0E-100
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 3791 5353 9.0E-99
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1239 2274 6.0E-98
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1239 2274 8.0E-98
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 45 1572 9.0E-98
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1242 2250 4.0E-97
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 4469 5354 3.0E-96
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1 1420 5.0E-96
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 1200 9.0E-96
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1654 2311 1.0E-95
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 4467 5322 1.0E-95
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 3825 5317 1.0E-94
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1242 2278 1.0E-94
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 139 1429 2.0E-93
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3337 4428 6.0E-93
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 187 1188 2.0E-92
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1129 2715 3.0E-92
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1 1557 5.0E-92
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 1212 6.0E-92
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1 1648 1.0E-91
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 163 1189 3.0E-91
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 163 1189 3.0E-91
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 163 1207 7.0E-91
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3395 4424 9.0E-91
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1266 2266 2.0E-90
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3395 4439 2.0E-90
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1656 2455 7.0E-90
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 4886 5350 1.0E-89
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1077 2623 1.0E-89
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1668 3682 2.0E-89
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 4465 5317 4.0E-89
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1238 2275 6.0E-89
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2327 3352 7.0E-89
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 3774 4428 8.0E-89
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1 1171 1.0E-87
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 3282 4738 2.0E-87
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1 1638 3.0E-87
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2327 3559 1.0E-86
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2327 3354 4.0E-85
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 535 1187 6.0E-85
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4463 5312 1.0E-84
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 159 1227 1.0E-84
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 157 1122 5.0E-84
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 4904 5352 6.0E-84
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1 1540 1.0E-83
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 4467 5353 1.0E-83
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 528 1198 2.0E-83
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 163 1197 4.0E-83
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1684 2642 5.0E-83
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 4467 5353 5.0E-83
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2439 3352 6.0E-83
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1 1197 7.0E-83
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 4904 5351 7.0E-83
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 4468 5317 7.0E-83
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1676 2471 1.0E-82
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 609 1535 6.0E-82
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3356 4439 7.0E-82
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3419 4452 9.0E-82
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1242 2203 2.0E-81
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 4904 5352 2.0E-81
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 4904 5352 2.0E-81
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 3392 4432 2.0E-81
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 4465 5317 3.0E-81
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2351 3352 1.0E-80
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1 1539 1.0E-80
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1 1376 2.0E-80
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2903 4429 2.0E-80
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 4841 5348 3.0E-80
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 4464 5317 5.0E-80
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 3 1538 8.0E-80
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2756 4529 8.0E-80
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2696 3342 8.0E-80
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1674 2492 1.0E-79
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1674 2492 2.0E-79
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1 1449 3.0E-79
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1247 2265 4.0E-79
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3393 4331 2.0E-78
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1236 2274 1.0E-77
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1 608 2.0E-77
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 4843 5322 2.0E-77
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 736 2329 2.0E-77
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2325 3353 3.0E-77
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 4468 5327 4.0E-77
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2200 3707 9.0E-77
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 4468 5320 1.0E-76
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 4590 5350 8.0E-76
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3785 4425 2.0E-75
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4897 5352 2.0E-75
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1813 3343 2.0E-75
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 6 1538 9.0E-75
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 4465 5317 1.0E-74
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 4839 5317 3.0E-74
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 3395 4424 3.0E-74
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2325 3267 2.0E-73
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1 1201 3.0E-73
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2436 3352 6.0E-73
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2760 3570 1.0E-72
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2760 3570 4.0E-72
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 4493 5352 4.0E-72
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 4465 5349 9.0E-72
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 4468 5325 1.0E-71
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 3820 4424 1.0E-71
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1 1177 2.0E-71
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2693 3536 4.0E-71
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1 1378 1.0E-70
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 3817 4747 2.0E-70
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 4465 5316 2.0E-70
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 3817 4747 2.0E-69
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2760 3573 9.0E-69
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 4354 5322 4.0E-68
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 3833 5340 6.0E-68
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1680 2510 2.0E-67
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 595 1441 4.0E-67
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 168 1207 9.0E-67
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1 1431 1.0E-66
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 594 1535 2.0E-66
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 4463 5317 2.0E-66
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1 1197 3.0E-66
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 597 1186 4.0E-66
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2678 3561 5.0E-66
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 597 1186 5.0E-66
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2436 3333 2.0E-65
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 3813 4431 2.0E-65
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 597 1510 1.0E-64
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 4473 5318 3.0E-64
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1 1432 8.0E-64
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1 1432 8.0E-64
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1341 2100 2.0E-63
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1641 2278 1.0E-62
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 4587 5321 3.0E-62
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 623 1556 5.0E-62
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2327 3352 2.0E-61
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3316 4774 3.0E-61
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3506 4429 4.0E-61
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 4587 5317 5.0E-61
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2436 3210 5.0E-61
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3397 4264 3.0E-60
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3748 4754 2.0E-59
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2130 3790 2.0E-59
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1668 2279 1.0E-58
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 165 1008 3.0E-58
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 621 1505 3.0E-57
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 597 1218 3.0E-57
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3790 4754 2.0E-56
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 4880 5353 6.0E-56
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2 1049 2.0E-55
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2758 3359 3.0E-55
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 4579 5332 3.0E-55
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 597 1200 6.0E-55
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4303 5348 1.0E-54
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 4758 5332 4.0E-54
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 4904 5336 2.0E-53
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 4904 5317 3.0E-53
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 4904 5352 7.0E-53
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 4898 5353 6.0E-52
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1626 2190 2.0E-51
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 3819 4416 2.0E-51
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 3819 4416 2.0E-51
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1702 2645 2.0E-51
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 4830 5317 2.0E-50
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2678 3352 6.0E-50
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1603 2275 9.0E-49
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1987 2693 9.0E-49
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2678 3343 5.0E-48
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2678 3343 6.0E-48
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 634 1560 6.0E-48
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1676 2283 1.0E-47
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 4683 5315 1.0E-47
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3846 4772 9.0E-47
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2341 3329 1.0E-46
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2341 3336 2.0E-46
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 910 1558 6.0E-46
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3071 3704 2.0E-44
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1658 2290 3.0E-44
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1658 2290 3.0E-44
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1676 2290 5.0E-44
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2341 3336 6.0E-44
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 255 1208 3.0E-43
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1676 2265 3.0E-43
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1676 2265 4.0E-43
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1676 2265 4.0E-43
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1676 2275 5.0E-43
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 4823 5352 8.0E-43
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1676 2274 8.0E-43
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 4139 4776 1.0E-42
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1256 2255 2.0E-42
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1447 2284 2.0E-42
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2730 3265 3.0E-42
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1676 2287 3.0E-42
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 609 1201 4.0E-42
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1674 2274 4.0E-42
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 609 1201 5.0E-42
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1256 2255 5.0E-42
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 4904 5322 6.0E-42
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 3731 4325 7.0E-42
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1702 2180 7.0E-42
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 3817 4429 1.0E-41
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 3817 4429 1.0E-41
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 3817 4429 1.0E-41
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 255 1208 2.0E-41
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 489 2.0E-41
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 3825 4440 3.0E-41
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1670 2255 4.0E-41
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 255 1208 7.0E-41
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 327 1197 8.0E-41
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 566 1103 9.0E-41
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 606 1197 1.0E-40
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1 552 2.0E-40
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 606 1209 3.0E-40
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 606 1209 4.0E-40
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 606 1209 4.0E-40
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 601 1172 6.0E-40
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1702 2269 8.0E-40
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 3719 4474 9.0E-40
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 3820 4424 1.0E-39
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2759 3352 1.0E-39
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 3415 4457 2.0E-39
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 3757 4424 2.0E-39
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 4745 5348 3.0E-39
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2570 3403 3.0E-39
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 3415 4457 4.0E-39
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1689 2180 5.0E-39
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1689 2180 5.0E-39
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1689 2180 5.0E-39
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1689 2180 6.0E-39
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1689 2180 7.0E-39
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1689 2180 7.0E-39
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1689 2180 7.0E-39
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1689 2180 7.0E-39
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1681 2180 7.0E-39
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1681 2180 7.0E-39
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1679 2180 7.0E-39
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1689 2180 8.0E-39
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1689 2180 9.0E-39
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1689 2180 1.0E-38
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1689 2180 3.0E-38
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 263 1198 4.0E-38
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 3830 4329 8.0E-38
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 3748 4457 2.0E-37
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2758 3332 2.0E-37
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2758 3332 2.0E-37
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2758 3332 2.0E-37
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 4857 5317 4.0E-37
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 3826 4334 4.0E-37
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1681 2180 8.0E-37
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 4857 5317 9.0E-37
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 4857 5317 1.0E-36
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1 482 1.0E-36
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1679 2182 1.0E-36
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2761 3265 1.0E-36
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2785 3722 2.0E-36
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 3503 4431 3.0E-36
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2669 3356 3.0E-36
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 623 1103 4.0E-36
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 3726 4425 5.0E-36
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 598 1103 5.0E-36
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 4911 5354 8.0E-36
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 598 1103 9.0E-36
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1681 2248 1.0E-35
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 598 1103 2.0E-35
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 598 1103 2.0E-35
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 598 1103 2.0E-35
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 598 1103 2.0E-35
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 598 1103 2.0E-35
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 598 1103 2.0E-35
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 601 1198 3.0E-35
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 598 1103 3.0E-35
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 4908 5322 4.0E-35
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 598 1103 4.0E-35
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 598 1103 4.0E-35
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 598 1103 4.0E-35
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 4908 5349 6.0E-35
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 623 1204 6.0E-35
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 598 1103 6.0E-35
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 4908 5349 7.0E-35
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 4908 5349 7.0E-35
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2761 3265 7.0E-35
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 598 1103 7.0E-35
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 598 1103 7.0E-35
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 3559 4425 8.0E-35
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 3820 4425 1.0E-34
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2761 3265 1.0E-34
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2761 3265 1.0E-34
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2761 3265 1.0E-34
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2761 3265 1.0E-34
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2761 3265 1.0E-34
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2761 3265 1.0E-34
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 3826 4329 1.0E-34
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 3826 4329 1.0E-34
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 3824 4331 2.0E-34
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2761 3265 2.0E-34
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 597 1103 2.0E-34
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1676 2180 2.0E-34
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1676 2180 2.0E-34
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1676 2180 2.0E-34
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1676 2180 2.0E-34
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2761 3265 3.0E-34
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2761 3265 3.0E-34
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2761 3265 3.0E-34
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2761 3265 3.0E-34
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1676 2180 3.0E-34
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 3824 4326 3.0E-34
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 3826 4329 4.0E-34
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 3826 4329 4.0E-34
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1700 2182 4.0E-34
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1739 2186 4.0E-34
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 4911 5354 4.0E-34
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 3826 4326 6.0E-34
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 3826 4329 6.0E-34
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1676 2180 6.0E-34
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2761 3265 8.0E-34
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 4911 5354 8.0E-34
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 3826 4329 8.0E-34
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1700 2181 1.0E-33
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1677 2186 1.0E-33
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2761 3265 1.0E-33
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 3826 4329 1.0E-33
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 4900 5354 2.0E-33
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 4900 5354 2.0E-33
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2672 3352 2.0E-33
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 598 1103 2.0E-33
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 4908 5331 3.0E-33
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 3826 4329 3.0E-33
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 4911 5321 3.0E-33
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 3826 4329 3.0E-33
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 4911 5321 3.0E-33
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2766 3265 3.0E-33
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 4916 5354 4.0E-33
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 3825 4329 5.0E-33
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 3826 4329 5.0E-33
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 3826 4329 7.0E-33
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 3826 4329 7.0E-33
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 3826 4329 7.0E-33
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1 555 7.0E-33
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1700 2181 8.0E-33
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 3826 4329 8.0E-33
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 3826 4329 8.0E-33
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 3826 4329 8.0E-33
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 3826 4329 8.0E-33
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 3826 4329 8.0E-33
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 623 1099 1.0E-32
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 520 1230 1.0E-32
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 4911 5321 1.0E-32
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 4911 5321 1.0E-32
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 4911 5321 1.0E-32
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 4911 5321 1.0E-32
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 4909 5321 1.0E-32
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 623 1099 1.0E-32
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 623 1099 1.0E-32
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1675 2182 1.0E-32
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 594 1104 1.0E-32
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1700 2181 2.0E-32
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 3830 4334 2.0E-32
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2688 3402 2.0E-32
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1677 2183 2.0E-32
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1677 2183 2.0E-32
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 3867 4419 2.0E-32
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1 555 2.0E-32
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 623 1099 2.0E-32
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 594 1105 3.0E-32
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2439 3352 3.0E-32
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1700 2181 3.0E-32
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1677 2183 3.0E-32
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 4911 5321 3.0E-32
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 4911 5321 3.0E-32
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 4911 5321 3.0E-32
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 4932 5349 3.0E-32
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 4932 5349 3.0E-32
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 4932 5349 3.0E-32
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 594 1105 4.0E-32
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 492 1188 4.0E-32
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 606 1198 4.0E-32
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2662 3209 4.0E-32
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 4911 5321 4.0E-32
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2769 3260 5.0E-32
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 594 1105 5.0E-32
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 3830 4334 5.0E-32
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 4911 5321 5.0E-32
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 598 1104 5.0E-32
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 3824 4330 6.0E-32
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1700 2181 6.0E-32
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 4911 5321 6.0E-32
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 4911 5321 7.0E-32
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 597 1103 9.0E-32
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1679 2186 1.0E-31
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 3824 4330 1.0E-31
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 3770 4425 1.0E-31
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2758 3256 1.0E-31
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1677 2183 1.0E-31
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 623 1099 1.0E-31
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 623 1099 1.0E-31
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 623 1099 1.0E-31
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 623 1099 1.0E-31
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 594 1105 2.0E-31
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 594 1105 2.0E-31
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 4911 5321 2.0E-31
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2761 3352 3.0E-31
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 621 1192 3.0E-31
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1700 2180 3.0E-31
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2761 3260 3.0E-31
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 3830 4326 4.0E-31
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 3830 4326 4.0E-31
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 3739 4268 4.0E-31
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 4911 5321 4.0E-31
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 597 1103 4.0E-31
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 3826 4326 4.0E-31
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2803 3347 5.0E-31
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 623 1099 5.0E-31
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 623 1099 5.0E-31
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 623 1099 5.0E-31
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1 529 6.0E-31
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 517 1047 7.0E-31
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 3830 4326 7.0E-31
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1689 2180 7.0E-31
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2769 3260 1.0E-30
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 3830 4326 1.0E-30
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 3824 4330 1.0E-30
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 3824 4330 2.0E-30
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2769 3260 2.0E-30
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2761 3352 2.0E-30
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1702 2180 2.0E-30
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1 460 2.0E-30
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 4932 5349 2.0E-30
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1700 2180 2.0E-30
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1700 2180 2.0E-30
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1700 2180 2.0E-30
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1700 2180 2.0E-30
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1702 2180 2.0E-30
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1700 2180 2.0E-30
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 3418 4439 2.0E-30
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1700 2180 3.0E-30
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1700 2180 3.0E-30
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1700 2180 3.0E-30
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 181 1194 3.0E-30
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 598 1103 4.0E-30
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 3824 4330 4.0E-30
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 3824 4330 4.0E-30
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2769 3260 7.0E-30
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1677 2184 7.0E-30
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2769 3263 7.0E-30
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2769 3260 9.0E-30
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 623 1103 1.0E-29
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 623 1103 1.0E-29
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 623 1103 1.0E-29
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 623 1103 1.0E-29
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 623 1103 1.0E-29
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1700 2180 1.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1700 2180 1.0E-29
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2779 3267 2.0E-29
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 4932 5349 2.0E-29
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 4902 5317 2.0E-29
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 4913 5308 2.0E-29
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 4932 5349 2.0E-29
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 4932 5349 2.0E-29
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 623 1103 2.0E-29
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 623 1103 2.0E-29
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 623 1103 2.0E-29
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 623 1103 2.0E-29
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 4911 5332 3.0E-29
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1702 2180 3.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 4932 5349 3.0E-29
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 4932 5349 3.0E-29
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 4932 5349 3.0E-29
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 4932 5349 3.0E-29
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2769 3260 4.0E-29
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 598 1099 4.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 3826 4325 5.0E-29
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 623 1103 5.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 623 1103 5.0E-29
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 3826 4325 7.0E-29
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 4827 5349 7.0E-29
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1677 2184 8.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1702 2180 8.0E-29
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1702 2180 8.0E-29
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1702 2180 8.0E-29
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1702 2180 8.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 3826 4325 1.0E-28
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 3826 4325 1.0E-28
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 3826 4325 1.0E-28
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 3826 4325 1.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 596 1103 1.0E-28
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 4915 5354 1.0E-28
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2786 3265 2.0E-28
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1670 2281 2.0E-28
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 3826 4325 2.0E-28
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 3826 4325 2.0E-28
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2766 3260 2.0E-28
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2769 3260 2.0E-28
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4389 5300 4.0E-28
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 4915 5322 5.0E-28
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 4915 5322 5.0E-28
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2779 3267 5.0E-28
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1702 2180 7.0E-28
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1702 2180 7.0E-28
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 4915 5322 8.0E-28
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 4911 5348 1.0E-27
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 4915 5322 2.0E-27
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 4915 5322 2.0E-27
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 596 1103 2.0E-27
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 596 1103 2.0E-27
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 596 1103 2.0E-27
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 596 1103 2.0E-27
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 596 1103 2.0E-27
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 596 1103 2.0E-27
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 596 1103 2.0E-27
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3289 3702 2.0E-27
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2779 3267 2.0E-27
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 596 1103 3.0E-27
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 4909 5323 3.0E-27
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1744 2087 3.0E-27
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 3826 4325 4.0E-27
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 3826 4325 4.0E-27
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 3826 4325 4.0E-27
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 596 1103 5.0E-27
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 4832 5349 7.0E-27
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 596 1103 1.0E-26
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 596 1103 1.0E-26
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 596 1103 1.0E-26
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 596 1103 1.0E-26
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 596 1103 1.0E-26
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 596 1103 1.0E-26
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 610 1103 2.0E-26
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1677 2098 2.0E-26
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4932 5317 2.0E-26
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 598 1103 3.0E-26
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 4909 5348 3.0E-26
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 599 1103 3.0E-26
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1134 1568 4.0E-26
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 598 1103 5.0E-26
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 598 1103 8.0E-26
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 3818 4326 3.0E-25
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 4932 5349 4.0E-25
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1 551 4.0E-25
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 78 987 4.0E-25
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2760 3326 5.0E-25
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1127 1566 6.0E-25
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 4909 5332 7.0E-25
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 4919 5322 8.0E-25
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 4932 5349 1.0E-24
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 4932 5349 1.0E-24
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 4932 5349 1.0E-24
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 4932 5349 1.0E-24
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 4932 5349 1.0E-24
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 4932 5349 2.0E-24
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 4932 5349 2.0E-24
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 4932 5349 2.0E-24
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 4974 5317 2.0E-24
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 4901 5332 3.0E-24
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 4932 5349 3.0E-24
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2211 2644 5.0E-24
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2786 3265 9.0E-24
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 3881 4418 9.0E-24
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 4901 5332 1.0E-23
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 4932 5349 1.0E-23
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 4932 5349 1.0E-23
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2786 3265 1.0E-23
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2786 3265 1.0E-23
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2769 3260 1.0E-23
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 163 555 3.0E-23
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 4913 5332 3.0E-23
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1 425 5.0E-23
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 4810 5322 7.0E-23
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4342 4774 9.0E-23
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2752 3182 1.0E-22
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 3826 4329 1.0E-22
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2766 3265 1.0E-22
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 665 1004 1.0E-22
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2752 3182 2.0E-22
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2752 3182 2.0E-22
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2211 2636 2.0E-22
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2752 3182 2.0E-22
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2752 3182 2.0E-22
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 4911 5321 2.0E-22
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2769 3256 4.0E-22
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 660 1171 4.0E-22
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2206 2627 5.0E-22
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 4641 5348 7.0E-22
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 4932 5349 8.0E-22
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 4908 5347 1.0E-21
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1236 1536 1.0E-21
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2769 3256 2.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1063 1537 2.0E-21
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 3824 4294 3.0E-21
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2752 3182 4.0E-21
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2752 3182 4.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3113 3679 5.0E-21
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 3826 4329 8.0E-21
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 3826 4329 8.0E-21
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2754 3265 9.0E-21
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 51 480 1.0E-20
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 3826 4329 1.0E-20
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 3826 4329 1.0E-20
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 3826 4329 1.0E-20
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 3826 4329 1.0E-20
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 3826 4329 1.0E-20
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 3826 4329 1.0E-20
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2757 3256 2.0E-20
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 3826 4329 2.0E-20
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 3826 4329 2.0E-20
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 3826 4329 2.0E-20
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 4965 5323 3.0E-20
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 4965 5323 3.0E-20
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 4965 5323 3.0E-20
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 4965 5323 3.0E-20
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 4965 5323 3.0E-20
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 4965 5323 3.0E-20
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 56 557 4.0E-20
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 4965 5323 6.0E-20
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 4965 5323 7.0E-20
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 4965 5323 9.0E-20
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 4965 5323 9.0E-20
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 4965 5323 9.0E-20
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 4965 5323 9.0E-20
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3283 3693 9.0E-20
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 4965 5323 9.0E-20
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 4965 5323 9.0E-20
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 4965 5323 9.0E-20
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1 563 1.0E-19
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1 555 1.0E-19
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1 299 1.0E-19
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2769 3256 2.0E-19
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 4908 5353 3.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3298 3710 4.0E-19
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2769 3256 4.0E-19
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 218 490 4.0E-19
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2813 3265 4.0E-19
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2813 3265 4.0E-19
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2813 3265 4.0E-19
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2813 3265 4.0E-19
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2813 3265 4.0E-19
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2813 3265 4.0E-19
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2769 3256 5.0E-19
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2769 3256 5.0E-19
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2769 3256 5.0E-19
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2769 3256 5.0E-19
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2769 3256 5.0E-19
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2769 3256 5.0E-19
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2769 3256 5.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1 460 5.0E-19
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2786 3265 5.0E-19
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2786 3265 5.0E-19
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2813 3265 6.0E-19
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2813 3265 6.0E-19
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2813 3265 6.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1 487 1.0E-18
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2769 3256 1.0E-18
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2769 3256 1.0E-18
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2769 3256 1.0E-18
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2769 3256 1.0E-18
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2769 3256 1.0E-18
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2769 3256 1.0E-18
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1677 2248 1.0E-18
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1131 1538 2.0E-18
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1067 1433 2.0E-18
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2140 2490 4.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2134 2589 4.0E-18
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 597 1009 4.0E-18
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 597 1009 4.0E-18
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2829 3177 2.0E-17
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 3847 4251 3.0E-17
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 4932 5317 3.0E-17
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1742 2254 7.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2327 2621 8.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4460 4881 9.0E-17
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 4349 4792 1.0E-16
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1735 2248 2.0E-16
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1818 2254 4.0E-16
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 1674 2182 6.0E-16
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 4292 4528 6.0E-16
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 619 1103 7.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 160 490 7.0E-16
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 741 1173 1.0E-15
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2785 3224 1.0E-15
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 621 1171 1.0E-15
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1 564 3.0E-15
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1 564 3.0E-15
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 3818 4265 3.0E-15
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 602 1004 5.0E-15
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 3846 4251 6.0E-15
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 2783 3177 7.0E-15
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2760 3200 1.0E-14
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 3812 4235 1.0E-14
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 83 469 2.0E-14
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3884 4235 2.0E-14
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 4906 5322 2.0E-14
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 4906 5322 2.0E-14
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 3865 4271 3.0E-14
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 3847 4235 3.0E-14
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 4932 5317 3.0E-14
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3395 3656 3.0E-14
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2785 3326 3.0E-14
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 3821 4332 4.0E-14
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 3812 4332 4.0E-14
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 1700 2183 4.0E-14
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 3812 4280 4.0E-14
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 1673 2087 5.0E-14
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 5043 5309 9.0E-14
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 5043 5309 1.0E-13
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 4911 5317 1.0E-13
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 5048 5347 1.0E-13
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 4908 5311 2.0E-13
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 609 1004 2.0E-13
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 595 1004 2.0E-13
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 3817 4330 2.0E-13
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 5043 5309 2.0E-13
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 616 1047 2.0E-13
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 5043 5309 2.0E-13
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 5043 5309 2.0E-13
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 5043 5309 2.0E-13
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4471 4746 2.0E-13
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 5043 5309 2.0E-13
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 5043 5309 2.0E-13
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 5043 5309 2.0E-13
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 5043 5309 2.0E-13
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 4932 5348 2.0E-13
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 1820 2184 2.0E-13
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 5048 5351 4.0E-13
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 1702 2184 4.0E-13
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1 109 4.0E-13
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 4911 5317 5.0E-13
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 5043 5349 5.0E-13
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 5043 5349 5.0E-13
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1 399 6.0E-13
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 727 1128 6.0E-13
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 738 1117 7.0E-13
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2820 3346 7.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 44 458 8.0E-13
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1 293 8.0E-13
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1 458 8.0E-13
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 1679 2183 1.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 1681 2081 1.0E-12
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 5043 5309 1.0E-12
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 621 1004 1.0E-12
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1134 1507 1.0E-12
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1 566 1.0E-12
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 4930 5317 2.0E-12
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2786 3177 2.0E-12
sp|A6WXV8|ACSA_OCHA4 Acetyl-coenzyme A synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=acsA PE=3 SV=1 1700 2184 2.0E-12
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 611 1132 2.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 3826 4329 3.0E-12
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 4965 5317 3.0E-12
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 3821 4298 3.0E-12
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 3821 4298 3.0E-12
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 5048 5309 4.0E-12
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 5048 5309 4.0E-12
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 5048 5309 4.0E-12
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 606 1104 4.0E-12
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 3847 4235 4.0E-12
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 5048 5309 4.0E-12
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 5048 5309 4.0E-12
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 1690 2184 4.0E-12
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 5048 5309 4.0E-12
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 3846 4333 5.0E-12
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3316 3780 5.0E-12
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2107 2723 5.0E-12
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2786 3177 5.0E-12
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|A9KY56|ACSA_SHEB9 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 1690 2184 5.0E-12
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 1700 2183 5.0E-12
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 5048 5309 5.0E-12
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 5048 5309 5.0E-12
sp|Q9PB89|ACSA_XYLFA Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 1820 2188 6.0E-12
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2769 3279 7.0E-12
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 1820 2184 7.0E-12
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 1690 2184 7.0E-12
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 5048 5309 7.0E-12
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 5048 5309 7.0E-12
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 2786 3227 7.0E-12
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 1749 2188 8.0E-12
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 1690 2184 1.0E-11
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 3826 4334 1.0E-11
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 5048 5309 1.0E-11
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 584 1004 1.0E-11
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 1690 2184 1.0E-11
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 1690 2184 1.0E-11
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 738 1112 1.0E-11
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 726 1112 1.0E-11
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 738 1112 1.0E-11
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 738 1112 1.0E-11
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 738 1112 1.0E-11
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 738 1112 1.0E-11
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2325 2595 1.0E-11
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 738 1112 1.0E-11
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 738 1112 1.0E-11
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 726 1112 1.0E-11
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 726 1112 1.0E-11
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 738 1112 1.0E-11
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 738 1112 1.0E-11
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 725 1112 1.0E-11
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 2769 3198 2.0E-11
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 5053 5312 2.0E-11
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 609 1097 2.0E-11
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 737 1104 2.0E-11
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 1690 2184 2.0E-11
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 1690 2184 2.0E-11
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 5050 5317 2.0E-11
sp|C0RF62|ACSA_BRUMB Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 1820 2184 2.0E-11
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 1690 2184 2.0E-11
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 1689 2081 2.0E-11
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 1820 2184 2.0E-11
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 738 1112 2.0E-11
sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 1700 2184 2.0E-11
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1238 1507 2.0E-11
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 2769 3198 2.0E-11
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2907 3177 3.0E-11
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 609 1004 3.0E-11
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 4930 5352 3.0E-11
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 4895 5317 3.0E-11
sp|B1ZB59|ACSA_METPB Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 1700 2184 3.0E-11
sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=acsA PE=3 SV=1 1820 2184 3.0E-11
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 726 1004 3.0E-11
sp|A9WWT6|ACSA_BRUSI Acetyl-coenzyme A synthetase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=acsA PE=3 SV=1 1820 2184 3.0E-11
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 1820 2188 3.0E-11
sp|Q8FYQ3|ACSA_BRUSU Acetyl-coenzyme A synthetase OS=Brucella suis biovar 1 (strain 1330) GN=acsA PE=3 SV=1 1820 2184 3.0E-11
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 1807 2181 3.0E-11
sp|A9M849|ACSA_BRUC2 Acetyl-coenzyme A synthetase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=acsA PE=3 SV=1 1820 2184 3.0E-11
sp|Q57B76|ACSA_BRUAB Acetyl-coenzyme A synthetase OS=Brucella abortus biovar 1 (strain 9-941) GN=acsA PE=3 SV=1 1820 2184 3.0E-11
sp|Q2YLH5|ACSA_BRUA2 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain 2308) GN=acsA PE=3 SV=1 1820 2184 3.0E-11
sp|B2S7N5|ACSA_BRUA1 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain S19) GN=acsA PE=3 SV=1 1820 2184 3.0E-11
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 1807 2181 3.0E-11
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 5204 5324 3.0E-11
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 725 1114 3.0E-11
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 725 1114 3.0E-11
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 1677 2182 4.0E-11
sp|Q8YJ48|ACSA_BRUME Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=acsA PE=3 SV=2 1820 2184 4.0E-11
sp|A4SJM6|ACSA_AERS4 Acetyl-coenzyme A synthetase OS=Aeromonas salmonicida (strain A449) GN=acsA PE=3 SV=1 1820 2184 4.0E-11
sp|B2IB12|ACSA_BEII9 Acetyl-coenzyme A synthetase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=acsA PE=3 SV=1 1702 2184 4.0E-11
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 3847 4300 4.0E-11
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 1807 2181 4.0E-11
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 1807 2181 4.0E-11
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 1807 2181 4.0E-11
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 1807 2181 4.0E-11
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 1807 2181 4.0E-11
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 1807 2181 4.0E-11
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 1807 2181 4.0E-11
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 3849 4330 4.0E-11
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 725 1114 4.0E-11
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 1700 2184 5.0E-11
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 609 1097 5.0E-11
sp|A4VKA0|ACSA_PSEU5 Acetyl-coenzyme A synthetase OS=Pseudomonas stutzeri (strain A1501) GN=acsA PE=3 SV=1 1820 2184 5.0E-11
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 1807 2181 5.0E-11
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 1807 2181 5.0E-11
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3317 3711 5.0E-11
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 597 1097 6.0E-11
sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 1678 2184 6.0E-11
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 1820 2188 6.0E-11
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 1820 2188 6.0E-11
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 1687 2180 6.0E-11
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 726 1112 6.0E-11
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 1807 2181 6.0E-11
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 1702 2087 7.0E-11
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 1698 2184 7.0E-11
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 1820 2184 7.0E-11
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3230 3366 7.0E-11
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 1807 2181 8.0E-11
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 1820 2188 8.0E-11
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 725 1114 8.0E-11
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 725 1114 8.0E-11
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 725 1114 8.0E-11
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 725 1114 8.0E-11
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 1807 2181 9.0E-11
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 1802 2184 9.0E-11
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1773 2184 9.0E-11
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 725 1114 9.0E-11
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 725 1114 9.0E-11
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 725 1114 9.0E-11
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 725 1114 9.0E-11
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2785 3259 1.0E-10
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2909 3194 1.0E-10
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2785 3177 1.0E-10
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 1677 2185 1.0E-10
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 2758 3177 1.0E-10
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 2903 3238 1.0E-10
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 1700 2184 1.0E-10
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 5048 5309 1.0E-10
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 1670 2184 1.0E-10
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 1702 2087 1.0E-10
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 596 1004 1.0E-10
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 725 1114 1.0E-10
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 725 1114 2.0E-10
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 4909 5321 2.0E-10
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 1900 2182 2.0E-10
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 1698 2184 2.0E-10
sp|Q2LW77|ACSA_SYNAS Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) GN=acsA PE=3 SV=1 1820 2184 2.0E-10
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 1677 2184 2.0E-10
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 4967 5317 2.0E-10
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 1687 2184 2.0E-10
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 1687 2184 2.0E-10
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 616 1057 2.0E-10
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 725 1114 2.0E-10
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 1702 2185 3.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1136 1547 3.0E-10
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 5049 5317 3.0E-10
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 4910 5325 3.0E-10
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3280 3687 3.0E-10
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 621 1004 3.0E-10
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 1807 2183 3.0E-10
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 1820 2184 3.0E-10
sp|Q7MBA6|ACSA_PHOLL Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 608 1108 3.0E-10
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 1820 2184 3.0E-10
sp|A1S7C8|ACSA_SHEAM Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 1700 2184 3.0E-10
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 4930 5317 3.0E-10
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 618 1097 3.0E-10
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 1807 2183 3.0E-10
sp|Q9I558|ACSA1_PSEAE Acetyl-coenzyme A synthetase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA1 PE=3 SV=1 1820 2184 3.0E-10
sp|A3QD52|ACSA_SHELP Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 1690 2184 3.0E-10
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 3826 4240 4.0E-10
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1 559 4.0E-10
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1 133 4.0E-10
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 5050 5317 4.0E-10
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 1678 2190 4.0E-10
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 1696 2087 4.0E-10
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 5048 5317 5.0E-10
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 597 1104 5.0E-10
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 612 1108 5.0E-10
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 612 1108 5.0E-10
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 612 1108 5.0E-10
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 612 1108 5.0E-10
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2785 3192 5.0E-10
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2785 3192 5.0E-10
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 3846 4240 5.0E-10
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 1687 2183 5.0E-10
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2785 3180 5.0E-10
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 609 972 6.0E-10
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 1670 2184 6.0E-10
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1701 2087 7.0E-10
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 3846 4235 7.0E-10
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 4351 4774 7.0E-10
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 4265 4838 7.0E-10
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 623 1047 7.0E-10
sp|B0TPY4|ACSA_SHEHH Acetyl-coenzyme A synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=acsA PE=3 SV=1 1690 2184 7.0E-10
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 739 1134 7.0E-10
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 1670 2184 7.0E-10
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 1670 2184 7.0E-10
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 1746 2184 7.0E-10
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 5043 5317 7.0E-10
sp|Q15YI8|ACSA_PSEA6 Acetyl-coenzyme A synthetase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=acsA PE=3 SV=1 1695 2184 7.0E-10
sp|A8FNJ7|ACSA_CAMJ8 Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 1796 2184 7.0E-10
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 3963 4252 8.0E-10
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 3843 4334 8.0E-10
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 3843 4334 8.0E-10
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 1670 2184 8.0E-10
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 3942 4280 8.0E-10
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 1820 2184 8.0E-10
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 624 1004 8.0E-10
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 1670 2184 9.0E-10
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 1690 2184 9.0E-10
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 1690 2184 9.0E-10
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2907 3328 1.0E-09
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1702 2081 1.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1819 2087 1.0E-09
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2785 3228 1.0E-09
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 1677 2182 1.0E-09
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 609 972 1.0E-09
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 5048 5347 1.0E-09
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 4932 5348 1.0E-09
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 609 972 1.0E-09
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 1810 2182 1.0E-09
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 609 972 1.0E-09
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 1820 2184 1.0E-09
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 612 1108 1.0E-09
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 1746 2184 1.0E-09
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 612 1108 1.0E-09
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 1746 2184 1.0E-09
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 739 1107 1.0E-09
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 5048 5347 1.0E-09
sp|A1W1D6|ACSA_CAMJJ Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acsA PE=3 SV=1 1796 2184 1.0E-09
sp|Q9PMD2|ACSA_CAMJE Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acsA PE=3 SV=1 1796 2184 1.0E-09
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 1807 2183 1.0E-09
sp|Q6FYL4|ACSA_BARQU Acetyl-coenzyme A synthetase OS=Bartonella quintana (strain Toulouse) GN=acsA PE=3 SV=1 1700 2184 1.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 581 2.0E-09
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1777 2178 2.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1702 2087 2.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 621 1004 2.0E-09
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2897 3177 2.0E-09
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 2890 3242 2.0E-09
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 4932 5317 2.0E-09
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 612 1104 2.0E-09
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 3846 4182 2.0E-09
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 1746 2184 2.0E-09
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 1746 2184 2.0E-09
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 1746 2184 2.0E-09
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 1746 2184 2.0E-09
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 609 972 2.0E-09
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 609 972 2.0E-09
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 1807 2181 2.0E-09
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 2890 3242 2.0E-09
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 5043 5309 2.0E-09
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 1687 2184 2.0E-09
sp|A8FUF1|ACSA_SHESH Acetyl-coenzyme A synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=acsA PE=3 SV=1 1820 2184 2.0E-09
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 4967 5317 2.0E-09
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 3825 4331 2.0E-09
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 736 1108 3.0E-09
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2784 3291 3.0E-09
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 3847 4300 3.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2784 3177 3.0E-09
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 3845 4300 3.0E-09
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 593 1104 3.0E-09
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 5050 5320 3.0E-09
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 1686 2087 3.0E-09
sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acsA PE=3 SV=1 1820 2184 3.0E-09
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 2890 3242 4.0E-09
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 2890 3242 4.0E-09
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 2890 3242 4.0E-09
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 2890 3242 4.0E-09
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 2890 3242 4.0E-09
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 2890 3242 4.0E-09
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 2890 3242 4.0E-09
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 609 972 4.0E-09
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 3841 4300 4.0E-09
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 612 1108 4.0E-09
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 2890 3178 4.0E-09
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 3845 4252 4.0E-09
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 3845 4252 4.0E-09
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 1823 2188 4.0E-09
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 3823 4265 4.0E-09
sp|A1UR36|ACSA_BARBK Acetyl-coenzyme A synthetase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=acsA PE=3 SV=1 1700 2184 4.0E-09
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 4902 5325 4.0E-09
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 2890 3242 5.0E-09
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 2890 3242 5.0E-09
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 609 972 5.0E-09
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 2890 3242 5.0E-09
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 621 1004 5.0E-09
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 1701 2184 5.0E-09
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 4920 5317 5.0E-09
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 1820 2184 5.0E-09
sp|A7HSR8|ACSA_PARL1 Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 1698 2184 5.0E-09
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 1807 2183 5.0E-09
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 1687 2184 5.0E-09
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 3961 4255 5.0E-09
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 1820 2184 6.0E-09
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 597 1104 6.0E-09
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 597 1104 6.0E-09
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 3847 4300 6.0E-09
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 1820 2184 6.0E-09
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 728 1111 6.0E-09
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 728 1111 6.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 637 1004 6.0E-09
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 3847 4280 6.0E-09
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 738 1099 6.0E-09
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 2890 3242 6.0E-09
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 2890 3242 6.0E-09
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 728 1111 7.0E-09
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 728 1111 7.0E-09
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 728 1111 7.0E-09
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 728 1111 7.0E-09
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 1820 2184 7.0E-09
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 3846 4251 7.0E-09
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 1820 2183 7.0E-09
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1 119 7.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1 222 7.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 5048 5317 7.0E-09
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 2890 3178 7.0E-09
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 609 972 8.0E-09
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 612 1116 8.0E-09
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 1815 2184 8.0E-09
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 1807 2181 8.0E-09
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 609 1097 9.0E-09
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 4918 5317 9.0E-09
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1 454 9.0E-09
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2223 2649 9.0E-09
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 1700 2182 1.0E-08
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 4932 5317 1.0E-08
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 621 1097 1.0E-08
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 1677 2182 1.0E-08
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 1700 2184 1.0E-08
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 1700 2184 1.0E-08
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 1820 2184 1.0E-08
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 612 1104 1.0E-08
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 1820 2184 1.0E-08
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 612 1104 1.0E-08
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 5035 5353 1.0E-08
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 5048 5353 1.0E-08
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2785 3180 1.0E-08
sp|Q6FXI2|ACS2_CANGA Acetyl-coenzyme A synthetase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS2 PE=3 SV=1 621 1128 1.0E-08
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 726 1104 1.0E-08
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 5009 5317 1.0E-08
sp|Q9I558|ACSA1_PSEAE Acetyl-coenzyme A synthetase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA1 PE=3 SV=1 612 1119 1.0E-08
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 1702 2194 1.0E-08
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 739 1004 1.0E-08
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 615 1004 1.0E-08
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 699 1111 1.0E-08
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 1674 2087 1.0E-08
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 1700 2182 1.0E-08
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 594 1039 2.0E-08
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 1807 2181 2.0E-08
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 1807 2181 2.0E-08
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 1700 2087 2.0E-08
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 1681 2081 2.0E-08
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 3847 4300 2.0E-08
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 3811 4240 2.0E-08
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 3811 4240 2.0E-08
sp|Q0VSR6|ACSA_ALCBS Acetyl-coenzyme A synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=acsA PE=3 SV=1 1820 2184 2.0E-08
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 1799 2181 2.0E-08
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 3847 4300 2.0E-08
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 1700 2184 2.0E-08
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 3847 4300 2.0E-08
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 1700 2183 2.0E-08
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 734 1109 2.0E-08
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 3847 4300 2.0E-08
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 3847 4300 2.0E-08
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 1698 2184 2.0E-08
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 3847 4300 2.0E-08
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 1820 2184 2.0E-08
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 3847 4300 2.0E-08
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 3847 4300 2.0E-08
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 623 1119 2.0E-08
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 1807 2181 2.0E-08
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1 131 2.0E-08
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2765 3177 3.0E-08
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 1690 2184 3.0E-08
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 3847 4300 3.0E-08
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 3847 4300 3.0E-08
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 3847 4300 3.0E-08
sp|Q88EH6|ACSA1_PSEPK Acetyl-coenzyme A synthetase 1 OS=Pseudomonas putida (strain KT2440) GN=acsA1 PE=3 SV=1 1820 2184 3.0E-08
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 1821 2182 3.0E-08
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 3845 4252 3.0E-08
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 736 1108 3.0E-08
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 3845 4240 3.0E-08
sp|A9IYZ3|ACSA_BART1 Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 1820 2184 3.0E-08
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 3845 4252 3.0E-08
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 2776 3285 3.0E-08
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 612 1124 3.0E-08
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 2776 3285 3.0E-08
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 2776 3285 3.0E-08
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 736 1108 3.0E-08
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 5048 5309 3.0E-08
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 4893 5317 3.0E-08
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 2780 3212 3.0E-08
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 2890 3242 3.0E-08
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 623 1119 3.0E-08
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 1815 2181 3.0E-08
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 1815 2181 3.0E-08
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 1815 2184 3.0E-08
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 1807 2181 3.0E-08
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 1810 2183 3.0E-08
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 1807 2181 3.0E-08
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 3837 4330 4.0E-08
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 3837 4330 4.0E-08
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 3837 4330 4.0E-08
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 736 1108 4.0E-08
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 737 1104 4.0E-08
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 1821 2184 4.0E-08
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 728 1111 4.0E-08
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 728 1111 4.0E-08
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 3847 4300 4.0E-08
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 612 1104 4.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 41 118 4.0E-08
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 609 972 4.0E-08
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 5044 5320 4.0E-08
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 726 1111 4.0E-08
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2723 3192 4.0E-08
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 3972 4331 4.0E-08
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 4909 5317 5.0E-08
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 2890 3208 5.0E-08
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 2890 3208 5.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 5035 5334 5.0E-08
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 1702 2181 5.0E-08
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 1810 2183 5.0E-08
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 736 1104 5.0E-08
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 609 972 5.0E-08
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 1807 2181 6.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 1796 2184 6.0E-08
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 3835 4235 6.0E-08
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 3855 4330 6.0E-08
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 609 972 6.0E-08
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 2890 3242 6.0E-08
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 2782 3177 7.0E-08
sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 612 1124 7.0E-08
sp|B1ZB59|ACSA_METPB Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 612 1124 7.0E-08
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 1696 2181 7.0E-08
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 3847 4300 7.0E-08
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 1820 2184 7.0E-08
sp|Q0AAW0|ACSA_ALKEH Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acsA PE=3 SV=1 1820 2184 7.0E-08
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 3847 4300 7.0E-08
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 5034 5348 7.0E-08
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 1810 2131 8.0E-08
sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 742 1124 8.0E-08
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 612 1104 8.0E-08
sp|B5ZV36|ACSA_RHILW Acetyl-coenzyme A synthetase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=acsA PE=3 SV=1 1820 2184 8.0E-08
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1821 2181 8.0E-08
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 623 958 8.0E-08
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 2890 3208 8.0E-08
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 2890 3208 8.0E-08
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 2890 3208 8.0E-08
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 2890 3208 8.0E-08
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 738 1111 9.0E-08
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 1702 2181 9.0E-08
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 1700 2183 9.0E-08
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 2890 3177 9.0E-08
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 3838 4236 9.0E-08
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 736 1104 1.0E-07
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 5027 5317 1.0E-07
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 2890 3208 1.0E-07
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 617 1039 1.0E-07
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 4911 5317 1.0E-07
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 1701 2081 1.0E-07
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2755 3181 1.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1242 1505 1.0E-07
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 1820 2183 1.0E-07
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2723 3192 1.0E-07
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 1702 2181 1.0E-07
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 1702 2181 1.0E-07
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 2785 3267 1.0E-07
sp|Q92KX2|ACSA_RHIME Acetyl-coenzyme A synthetase OS=Rhizobium meliloti (strain 1021) GN=acsA1 PE=3 SV=1 1698 2184 1.0E-07
sp|Q8UBV5|ACSA_AGRFC Acetyl-coenzyme A synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acsA PE=3 SV=2 1820 2184 1.0E-07
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 2894 3178 1.0E-07
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 2890 3208 1.0E-07
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 1819 2184 1.0E-07
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 726 1111 1.0E-07
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 5050 5317 2.0E-07
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 5050 5317 2.0E-07
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 5050 5317 2.0E-07
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 5050 5317 2.0E-07
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 5050 5317 2.0E-07
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 5050 5317 2.0E-07
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 1768 2087 2.0E-07
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 3934 4333 2.0E-07
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 4918 5350 2.0E-07
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 3830 4334 2.0E-07
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 621 1104 2.0E-07
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 3823 4330 2.0E-07
sp|Q9KWA3|ACSA_AGRRH Acetyl-coenzyme A synthetase OS=Agrobacterium rhizogenes GN=acsA PE=3 SV=1 1820 2184 2.0E-07
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 3847 4300 2.0E-07
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 1820 2184 2.0E-07
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 3972 4331 2.0E-07
sp|Q54Z60|ACSA_DICDI Acetyl-coenzyme A synthetase OS=Dictyostelium discoideum GN=acsA PE=3 SV=1 1703 2204 2.0E-07
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 2903 3208 2.0E-07
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 2903 3208 2.0E-07
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 2890 3208 2.0E-07
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1690 2064 2.0E-07
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 2897 3180 2.0E-07
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 609 1004 2.0E-07
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 2890 3208 2.0E-07
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 715 1008 3.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 1740 2091 3.0E-07
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 1696 2181 3.0E-07
sp|C3MAS0|ACSA_RHISN Acetyl-coenzyme A synthetase OS=Rhizobium sp. (strain NGR234) GN=acsA PE=3 SV=1 1700 2184 3.0E-07
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 1702 2188 3.0E-07
sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=acsA PE=3 SV=1 1820 2184 3.0E-07
sp|B9JEV4|ACSA_AGRRK Acetyl-coenzyme A synthetase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=acsA PE=3 SV=1 1820 2184 3.0E-07
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 3847 4300 3.0E-07
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 3847 4258 3.0E-07
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 3826 4238 4.0E-07
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1815 2087 4.0E-07
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 5050 5317 4.0E-07
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 5050 5317 4.0E-07
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 593 1104 4.0E-07
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 609 1012 4.0E-07
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 4917 5325 4.0E-07
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 1681 2081 4.0E-07
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 1810 2182 4.0E-07
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 5048 5324 4.0E-07
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 2894 3178 4.0E-07
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 732 1004 5.0E-07
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 3838 4236 5.0E-07
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 1806 2184 5.0E-07
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 1806 2184 5.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3505 3656 5.0E-07
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 4909 5317 5.0E-07
sp|Q7N7A9|AAS_PHOLL Bifunctional protein Aas OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aas PE=3 SV=1 5048 5299 5.0E-07
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 1820 2184 5.0E-07
sp|Q9NR19|ACSA_HUMAN Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens GN=ACSS2 PE=1 SV=1 1820 2184 5.0E-07
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 3825 4332 5.0E-07
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 3938 4341 5.0E-07
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 2904 3180 5.0E-07
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 1702 2087 6.0E-07
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 3843 4331 6.0E-07
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1132 1536 6.0E-07
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 4932 5320 6.0E-07
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 5048 5321 6.0E-07
sp|B9JV43|ACSA_AGRVS Acetyl-coenzyme A synthetase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=acsA PE=3 SV=1 1820 2184 6.0E-07
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 1702 2181 6.0E-07
sp|Q88DW6|ACSA2_PSEPK Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain KT2440) GN=acsA2 PE=3 SV=1 1820 2184 6.0E-07
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 4920 5317 7.0E-07
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 4930 5317 8.0E-07
sp|Q6G1W0|ACSA_BARHE Acetyl-coenzyme A synthetase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=acsA PE=3 SV=1 1820 2184 8.0E-07
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 1810 2182 8.0E-07
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 5044 5317 8.0E-07
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 4911 5317 8.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 5046 5352 9.0E-07
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 1820 2183 9.0E-07
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 619 1040 9.0E-07
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 597 1110 1.0E-06
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 3820 4330 1.0E-06
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 3925 4330 1.0E-06
sp|A4VKA0|ACSA_PSEU5 Acetyl-coenzyme A synthetase OS=Pseudomonas stutzeri (strain A1501) GN=acsA PE=3 SV=1 612 1108 1.0E-06
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 3925 4330 1.0E-06
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 3925 4330 1.0E-06
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 1702 2181 1.0E-06
sp|B3PS41|ACSA_RHIE6 Acetyl-coenzyme A synthetase OS=Rhizobium etli (strain CIAT 652) GN=acsA PE=3 SV=1 1820 2184 1.0E-06
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 1821 2087 1.0E-06
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 5011 5317 1.0E-06
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 1675 2087 1.0E-06
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 5055 5317 2.0E-06
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 1819 2184 2.0E-06
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 1819 2184 2.0E-06
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 1819 2184 2.0E-06
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 1819 2184 2.0E-06
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 4957 5317 2.0E-06
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 1702 2181 2.0E-06
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 3925 4330 2.0E-06
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 3925 4330 2.0E-06
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 3925 4330 2.0E-06
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 1815 2184 2.0E-06
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 3925 4330 2.0E-06
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 2903 3242 2.0E-06
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 3925 4330 2.0E-06
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 3925 4330 2.0E-06
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 594 958 2.0E-06
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 3880 4235 2.0E-06
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 617 1047 2.0E-06
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 4967 5317 2.0E-06
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 1698 2182 2.0E-06
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 736 1119 2.0E-06
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 1698 2182 2.0E-06
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 4911 5334 2.0E-06
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 4911 5334 2.0E-06
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 3847 4300 2.0E-06
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 3847 4300 2.0E-06
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 3847 4300 2.0E-06
sp|A1WY97|ACSA_HALHL Acetyl-coenzyme A synthetase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=acsA PE=3 SV=1 1820 2184 2.0E-06
sp|Q2K2T1|ACSA_RHIEC Acetyl-coenzyme A synthetase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=acsA PE=3 SV=1 1700 2184 2.0E-06
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 1823 2182 2.0E-06
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 4920 5317 3.0E-06
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 736 1036 3.0E-06
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 4292 4443 3.0E-06
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 2806 3127 3.0E-06
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 594 1021 3.0E-06
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 594 1021 3.0E-06
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 1702 2087 3.0E-06
sp|A6UED8|ACSA_SINMW Acetyl-coenzyme A synthetase OS=Sinorhizobium medicae (strain WSM419) GN=acsA PE=3 SV=1 1678 2184 3.0E-06
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 2906 3198 3.0E-06
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 1702 2181 3.0E-06
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 1702 2181 3.0E-06
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 1821 2087 3.0E-06
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 1702 2181 4.0E-06
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 1821 2182 4.0E-06
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 609 1004 4.0E-06
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 3972 4331 4.0E-06
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 4912 5317 4.0E-06
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 1702 2181 4.0E-06
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1 119 4.0E-06
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 1819 2184 5.0E-06
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 1819 2184 5.0E-06
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2 127 5.0E-06
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 3925 4330 5.0E-06
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 3925 4330 5.0E-06
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1819 2087 5.0E-06
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 4923 5322 5.0E-06
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 736 1108 5.0E-06
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 1820 2184 5.0E-06
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1 134 5.0E-06
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 3967 4235 6.0E-06
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 1819 2184 6.0E-06
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 1819 2184 6.0E-06
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 594 958 6.0E-06
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 3962 4330 6.0E-06
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 3925 4330 6.0E-06
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 3925 4330 6.0E-06
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2779 3180 7.0E-06
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 3925 4330 7.0E-06
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 1702 2181 7.0E-06
sp|A4WJG1|ACSA_PYRAR Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=acsA PE=3 SV=1 1810 2202 7.0E-06
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 1664 2087 8.0E-06
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 623 1097 8.0E-06
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 623 1097 8.0E-06
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 623 1097 8.0E-06
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 5044 5317 8.0E-06
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 4292 4443 8.0E-06
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 1702 2181 9.0E-06
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 3972 4331 9.0E-06
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2907 3177 9.0E-06
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 5002 5322 1.0E-05
sp|P16929|ACSA_NEUCR Acetyl-coenzyme A synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-5 PE=2 SV=2 3823 4257 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2027
MVPSYYLPVAHLPLSLSGKVDAQKLREWAEQLSAHNLVEYSVAERTEYEPPTTDIEKKLQHLWASALEIPIETIG
RNESFLALGGDSIAAIRLVAAARSQDITLSVSSIFKHPQLSQMALSARLEKVVQDEALEAWGMIAQDERQSIEDS
IREHCQLSAQDIIEDVYPATPLQEGLMALAVKQPGSYMATFTYRLADDVDAEYFQKAWETTLQVCSVLRTRIVVH
RDRTLQAIVKTPQKDWLNEKNSCSRHMQYGTPLCYSSLERGTDTSLFRLTMHHAIFDGWSFGLIMRTLSQAYSGA
AKPDLSLPHYGNFVKYALSLDKSDAAEYWSSQLKGATRPMFPARQTAKSPKPASATLTCHIPLDTGRQLPVTKAT
LLRAAWAVLMARYNDTDDISFGAAVAGRQAPISGIEEIVGPVLSTVPVRVKVPGQQSISDFLQTLQTQATDMIPF
EHMGLQNIAKLGLDAREACDFSSMFSVQHNTIASKGTSSLLISIVNTSPDTALNFATYFTYPLVGQCFLSEHEAS
LELIYNSASLSSQQVEGLAAQYCHVIEQLVTHITEAKETPRLKDIEIFGAWDKTQIEQWHSLQEPVTMLGTTVLE
LLSTVSTKSPDDEAICAWDGSCTYAELENMTTDLASHLQSLKVGKGSLVPICFEKSLWTVVAKMAILKAGAAFVP
LNPDHPLTRRKQLVDVLESPLILVSEATQQSCQDMNLPLVTISEACVSRLPQCTSKRDYPSSQDTAYVLFTSGST
GEPKGVVVSHGALASCVLSHARDIGVQPESRVLQFSAYTFDISLAETLCTLCFGGCLCIPSTEERLSSLTAFVRD
RRINVTMLTPTMLSTISPQEIPGVDTVVLVGEPSTQSTLDTWSDKVTLINNYGPSEASINTSSHLILPGQKSPRM
IGSGCNSRLWIVEPDNTESLAPVGCVGELVIQAASIADGYLNDVKRSKESFIQAPSWLPQGTLPKLYKSGDLVRY
HNDGTLEYVGRKDGQLKVRGQRLESGEVEYHIKQILGPRSTSSVQLIQGENVGGKALVAFVCLSGSTRCIDDGEC
HSLWARDDNTFDLLFSLHQSLRSVLPDYMVPSYFLPVAYLPVTSSGKTDGRTIRTWASTIERDDMAQFSLSSSVP
FVPPTTAMEKKLQGMWADVLGIPAESIGCEDNFLDRGGDSIAAIHLVSMARQHGIALTVSSIFSDARLSHVAASA
VPLKDENGDGNVDPWALIPKEDQAQVIESVRQQCRLSTEQAIDDVYPATALQEGLMALAAKQPGSYVARFTFELG
RAVDTSRFKEAFSHTVASCSTLRTRLILWRDQTVQAVLKHSDVWPLEGVQKSEAMGYGTPLFLYALRDRGSRREF
HLAMHHAIFDGWSVGLIMRTLSQFYHQGRVQRPLVPYVNFVKYAQSLDGEQANEFWRSQLQGASKTTFPKRTASS
ASCSQTLIRQIHLRHHVGSNSAITTATVLRAAWAIVLARYNDSAPNVTFGAAVAGRQAPVPGIDDIVGPVLSTVP
MRVNLEGTELVTSFLQRIQAQSVDMMPFEQLGLQNISRLGPDAKNACDFSSLLIIQHRGIFHTGEESLLVVPEDW
SASTGGGEATYFNYPIVVQCFLLEQKVMLELIYDDAAVTSDQAQAIASHYINVVQQLIKAQERREQDQLVLSDIS
LFGEWDAEKIQEWHQGQPPMETVDTCMHDLISKTTRMLPDKEAVFAWDGKCSYAELECMTHSLAHYLREQGVGHE
SLVPICFEKSIWAIVAMLGIMRAGGAFVPLNPNDPFARRQHLVASLQAPLILASCSTSSLFDGIGVNTVVIASEL
ISSLPTAQVESITTPHSVAYVLFTSGSTGEPKGVIVEHRSLCSTISHRGDDIGLTADWRILQFSSYVFDISVCEI
FASLAHGATLCVPSEADRVNSLAGFINKAEVTCAMLTSTVAKLLTPADVPSLTTLLLVGEAPTVENARTWADAVK
LFNDYGPAEACIFVTSRLILPSASTTNIGSGCNARLWVVEPDDHNRLAPVGCTGHLVIQGPGVARGYLNDAGRTA
EAFLSTTPWQSSASVHKLYKTGDLVRYTNDGSLEYIGRKDGQIKLRGQRLEPGEIEYHIKHHLGPQSTSSVQIIH
GPAMGEGALFAFVCLVGQTDMLAASEGDLISTFDEDTQHLLQDLDEALRASLPAYMVPSHYVPVKWLPVTPSGKM
NSRSLREIALCLPPSDLAQYSLSTRAEFEPPQTPMEVHMVELWADILGCLSQNIGRSDNFLQIGGDSIMAIRLVA
AARKQNINLAVSTIFRDARLSQVAAAAELSSNGPVEHADVEPWSLLPQNDSSAIAKSVRQQCFFPPHADNDDDGD
IIQDVYPATPLQEGLMALAVKQPGSYMARFSFKLADDVDIHRFREAWQATLTACDVLRTRLVLFGEHTLQAVLCP
RGQWQNLNTKNVTMSYGTPLCSYALVDNDTGLHFELVLHHAIFDGWSLKIILRTLLTAYCQNESQKSPRLPRYAN
FIRYSLTLNTNEAEEFWKQQLRGAARPIFPKQLLAQNAASSQAITREMPLRAIGRLNITTATVLRTAWAIVLARY
NDATNNITFGAAVAGRQAPVAGIEDIVGPIISTVPVRISLDPEQSVHHLLQRIQAQATDMMAFEQFGLQKIAKLS
PDARNACAFSSLLVVQPDAVFGKTSNSVMVLEPGNDNKNAASPLAEYFSYPLVWQCHVTDSAIHLHAIFDSSVLS
KQQINAMAEQFCHVVQQLCNAEAEPANKTRTRDISLSGPFDLALAQEWNDAVDTKVISDTLHAQFEKQAKRRPGA
PAIFAWDGCLSYRELDTAADHLAQLLRQQYGVGPDDLVLVCFEKSIWFYVAILAINKAGGAWVPIDPSHPAHRHK
KIADQASASLALASATAAASCIGLVKNVVQVSSALHEELLLKPLEMPAVEVLPHHAAYVLFTSGTTGTPKGIIME
HGSLCTSQTAISRRLNLDENVRMLQFAAYVFDLSIGEMIAPLISGACLCVPAEHHRKSLTDLSVFMREARVNWAY
LTPSFARLIDPDTMPGLELLLLAGEAVGKDLLETWASRVRLVNGWGPSETCCFSSLNEWDSASQSPLNIGYPVGG
RCWITEPDNHHQLAPIGCVGEVLIQGPTIAREYLDYAQGTRMNFITQDLPGWAPDQDLAPYSRLYKSGDLAYYNP
DGTLEFVARKDTQVKVSGFRVELVEIEHYIRQGLGGVEQIIVDVVESRASSKPRLAAFVCFSLATSAPSHDLDES
DLLLPLDAALTRQLSELKGYLQARVPAYMVPSIYIPVRPNLPDHMLTQYMLADMQKESPTTYQEAMMQGLWADVL
HISPDLIGRSDSFLLLGGDSLAAIRLVARAREKGIRVSVASIFSDPRLSQVAGAASFEQFEHTMVEPWSLISTNE
RASLIEVARKQCSLAPNDVIYDIYPTSALQEGLMALATKQSGSYMARFTFDLDDMIDLNRFKEAWQYTLEACDAL
RTHIILHGATTLQAVVHQEQAIQWKQDGLGALKMEYGTPLCEYALNQHSSPKRFELALHHAIFDGWSFGLIMRTL
SESYHGAKITPLFPYASFVKYAKSIDIKSASDYWREQLNGATRPVFPRSSTTSGESSSQSFAREIPVPQGKPGVT
VATVLRAAWAIVLARYNDDVSDITFGAAVSGRQAPVEHIEDIVGPVISTVPIRVKLLKECRASDFLQGLQRQAAE
MMAFEQMGLQNINKLGTDAKNACDFSTLLVIQPRAIFRELSHSFMSMTQEDGQGASLSEYFSYPLVWQCHVSEQG
KIHLYAIFDTNVLSEAQINIMAEQYCHVIHQLWLADNSQILLKDVSLCSPYDMNLALTWSAPSETLPVRETFHSL
VERQAKAQPNAPAIYAWDGELSYGELYAAADRLSRLLTHKLGVKLEERVIVCLEKSLWFYVAILAVNMAGGVWVP
FDPSHPRDRHNKIASQAGARIALTWPDNEQKLQGLVEHIIQLSADLDQELLLDANKYPPVYVQVEPSNAAYILFT
SGTTGTPKGIVMEHGALCTSQIAIGKKLGMGTDVRLLQFAAYVFDLSIGEMIGPLVAGGCLCVPSEHDRMNNLGG
FISQARVNWAYLTPSFARLIEPTSVPGLELLLLAGEPVGKDHLKSWIGRVRLINGWGPSETCCFSSLQEWDSIDQ
SPLTIGRSVGARCWIVESDNLERLAPIGCIGEIVIQGPTIAREYLANDEGTRASFVERLPSWAPDAPGHRRLYRS
GDLGYYNADGTMEFVSRKDTQVKVRGFRVELGEVEHHIRQSLREAHQVVVDVHQDSTKLVAYVCFSSETSNSSNS
SDMIRPMDSSLAAKFSELKSYLGVRLPEYMIPAVYVPLKFVPFITSQKIDRAVLRDATSPANMKGDDLARYMLAD
TSKETPASEREITMQKLWADVLRVSIELIGRHDSFLQLGGDSLAAIRLVTQARKQGIQLTVAQIFRDPRLSQVAA
VAQFGESIEETSSVQPWSLISSSRRGTMRTVIQRQCNLRSADEILDVYPATALQEGLMALTARQPGAYVTRYIFQ
IGHDVNVDRFKTAWEQTVQSIDALRTRIVFHGGKTWQAKLDQGAEWLPTQRFSKYKTPIEALAMGYGTRLCLYAL
VDGDSGDKYFALTMHHSIYDGWCLQLIAQTIKHFYDANPSPIGLAPYANFIDFTLRLDLKAAAAFWKKQLGGAKR
TIYPQMVKKPKLNSETSGKTLCYEITLRKSAGTVTMATVLRAAWAIVLGRYNDDADDVTFASTVTGRQTPVSGVD
RMVGPVISTVPVRVKLDKTQSVGQFLHSVHLDAAEMIPFEQMGLQNIAKLGVEMREACNVSTLLVVQPEELFEQS
TNGLLSSQPTEADALFKGYFNYPLVALIYLRSDCAFLNLIYDASAISTAQVNRMAKQYEHVVEQLLAYGDDSSRT
VDDINLCSTADMDQVLQWHDALEPMDITNACAHQLISQTAAQTPDQEAIFAWDGTCTYGELDRMATHLASFLACQ
GVGPESLVPVCFEKSMWIVVAILAIQKAGGAYVPLSPEHPLLRRQQLVAKIKAPLLLTSIAAESACQGIQVPIVV
VSRDTIAGLSDKTQHGAAESVCNPNNAAYVLFTSGTTGEPKGVVAEHKALVSGLFHFARKTGLSSATRMLQFSNY
IFDVSVSEIFGTLLHGGCICIPSEAERMDNIETFVNRSRANFAMVTPSFAGTLSPAKMPTLEAMILGGEALTMDN
IQTWASKVRLFNNYGPAEAGVSTSQHLVEPGSSEPSIVGSGCNNRLWIIEPSNSDRLTPIGCVGELAVQGPCVSR
GYLEDETRTKASFLESPCWLPSGAAHRRVYKTGDLVRYSDDGSVVFVGRKDGQIKLRGQRLEPGEIEYWIKKSLG
QRHTVSVQLMHGVDAGASLVAFVCAPPEE*
Coding >OphauB2|2027
ATGGTGCCGTCTTACTATTTGCCCGTTGCGCATCTTCCACTCAGTCTTTCTGGCAAAGTCGACGCCCAAAAGCTA
CGCGAATGGGCCGAACAATTATCAGCCCACAACCTTGTAGAGTATTCCGTCGCTGAACGAACAGAATATGAGCCT
CCGACAACAGACATAGAAAAGAAGCTTCAGCATCTCTGGGCATCAGCCTTGGAAATACCTATAGAGACAATTGGT
CGCAATGAAAGCTTTCTCGCACTGGGCGGCGACTCCATCGCGGCTATTCGCCTCGTGGCGGCTGCTCGAAGCCAA
GACATTACTCTTTCCGTCTCGTCCATCTTCAAACACCCCCAGCTGTCCCAGATGGCCTTGTCCGCCCGCCTCGAA
AAGGTGGTACAAGATGAGGCTTTGGAGGCATGGGGCATGATTGCGCAGGACGAGCGACAATCGATAGAGGACAGC
ATTCGAGAGCATTGTCAACTATCAGCACAAGATATCATTGAAGATGTCTATCCGGCGACACCGTTGCAAGAGGGT
CTCATGGCGTTGGCCGTGAAGCAGCCTGGTTCATACATGGCCACCTTTACATATCGACTTGCAGACGACGTCGAC
GCCGAATATTTCCAGAAAGCCTGGGAGACAACCCTGCAAGTCTGTAGCGTGCTTCGGACTCGAATTGTTGTTCAT
CGTGACCGAACTCTTCAAGCCATAGTTAAAACACCCCAAAAGGATTGGCTAAACGAGAAGAATAGTTGCTCGCGC
CACATGCAATACGGCACGCCACTATGCTACTCGTCTCTTGAGCGCGGCACTGACACCTCCTTGTTCCGTCTAACA
ATGCACCACGCAATATTTGATGGCTGGAGTTTTGGTCTCATTATGCGCACGCTGTCACAAGCCTACAGCGGCGCG
GCCAAACCCGATTTGTCTTTGCCTCATTATGGCAATTTTGTCAAGTATGCTCTTTCGCTCGACAAGTCTGACGCT
GCAGAATACTGGTCTAGCCAGCTCAAGGGCGCTACACGACCAATGTTTCCTGCGCGCCAGACGGCCAAATCGCCG
AAGCCGGCAAGCGCAACATTAACCTGCCACATACCGCTCGATACAGGGCGCCAGTTGCCCGTCACCAAGGCCACC
CTTCTCCGAGCTGCATGGGCTGTTTTAATGGCGCGATACAACGACACAGACGACATTTCTTTTGGAGCTGCAGTC
GCTGGGCGGCAAGCCCCCATCTCCGGTATCGAGGAAATAGTTGGCCCAGTCCTCTCGACCGTTCCGGTGCGAGTC
AAAGTTCCTGGCCAGCAGTCTATTAGTGACTTTTTGCAAACGCTACAGACACAAGCAACTGACATGATTCCATTC
GAGCACATGGGGCTGCAAAATATTGCCAAGCTGGGACTAGACGCGCGAGAAGCCTGTGACTTTTCTTCCATGTTT
TCGGTGCAGCATAACACAATTGCAAGCAAGGGAACGTCTTCATTGCTCATCTCAATTGTCAATACCTCCCCTGAT
ACCGCGCTCAACTTTGCTACTTACTTTACTTATCCGCTTGTCGGGCAATGCTTCCTCTCAGAGCATGAGGCCTCC
TTGGAGCTAATCTACAACTCCGCGTCACTCTCTTCTCAGCAGGTAGAGGGCCTGGCTGCTCAGTACTGTCATGTG
ATTGAGCAGCTGGTTACCCATATCACGGAAGCCAAGGAGACGCCACGGCTTAAAGACATTGAGATTTTCGGAGCG
TGGGACAAGACGCAGATTGAGCAATGGCATAGTCTTCAAGAGCCAGTCACCATGCTTGGCACCACCGTCTTGGAG
CTGCTCTCTACAGTTTCGACGAAATCACCAGATGACGAAGCCATTTGCGCATGGGACGGCAGCTGCACATATGCC
GAGCTAGAAAATATGACAACTGACTTGGCAAGTCACCTGCAAAGCCTTAAAGTCGGCAAGGGCTCGCTGGTTCCA
ATTTGCTTTGAAAAGTCCTTATGGACAGTAGTTGCTAAGATGGCCATCTTGAAGGCCGGCGCTGCCTTTGTCCCA
TTGAACCCCGATCATCCTTTGACCCGGCGAAAGCAGCTTGTGGACGTTCTCGAATCACCTCTGATTCTTGTTTCT
GAAGCTACGCAGCAATCTTGTCAAGACATGAACCTGCCACTTGTTACTATCTCAGAGGCCTGCGTGTCGAGACTA
CCCCAATGCACTTCGAAGCGAGATTATCCCAGCTCACAAGACACAGCATATGTTCTGTTTACCTCTGGCAGTACA
GGTGAGCCCAAGGGAGTTGTTGTGAGCCACGGTGCCCTAGCATCTTGCGTGCTCTCTCATGCACGGGATATTGGT
GTCCAGCCCGAGAGCCGAGTGCTACAATTCTCGGCCTATACTTTTGACATTAGTCTAGCAGAGACACTTTGCACT
CTTTGTTTTGGAGGCTGCTTGTGCATTCCGTCAACCGAGGAGCGTCTAAGCAGCTTGACAGCTTTTGTGCGAGAC
CGCCGGATAAACGTCACCATGCTCACGCCAACGATGCTATCAACAATATCTCCCCAAGAAATTCCTGGCGTTGAT
ACCGTCGTCCTCGTCGGTGAGCCAAGTACGCAGTCAACTTTGGATACTTGGTCAGACAAGGTGACTCTTATCAAC
AACTACGGGCCCAGTGAGGCTTCAATCAATACTAGCAGTCATCTGATTCTTCCGGGCCAAAAATCACCGCGAATG
ATTGGATCTGGATGCAACTCACGTCTTTGGATTGTCGAGCCTGATAATACCGAGTCTTTAGCTCCGGTTGGGTGT
GTTGGAGAGCTTGTGATTCAAGCAGCATCTATTGCCGATGGTTACCTAAACGACGTAAAACGGTCCAAAGAATCG
TTCATTCAAGCCCCTTCATGGCTTCCACAAGGGACTCTTCCAAAGCTATATAAGTCTGGAGATCTTGTGCGCTAT
CATAACGATGGAACACTGGAATATGTGGGGCGTAAAGATGGTCAGCTCAAGGTTCGTGGACAGAGACTTGAATCC
GGCGAAGTCGAATACCACATTAAACAGATACTTGGCCCACGATCAACCTCATCAGTTCAACTCATCCAAGGAGAA
AACGTTGGCGGCAAGGCCCTAGTGGCTTTTGTCTGTCTATCGGGTAGCACCCGCTGCATCGATGATGGCGAATGT
CACTCATTGTGGGCAAGAGACGACAACACATTCGATCTTCTCTTTAGCCTCCACCAGAGTCTCCGAAGTGTTTTG
CCTGACTATATGGTGCCTTCCTACTTTCTCCCAGTCGCATACCTCCCCGTAACATCTTCGGGCAAGACAGACGGG
CGAACAATTCGAACATGGGCTTCTACCATAGAGCGAGACGACATGGCGCAATTTTCCCTTTCTTCAAGTGTGCCA
TTTGTTCCGCCAACGACAGCCATGGAAAAGAAGCTTCAGGGGATGTGGGCAGACGTCCTTGGGATACCAGCGGAG
TCGATTGGCTGCGAGGATAACTTTCTTGATCGAGGAGGCGATTCCATTGCAGCTATTCACTTGGTCTCAATGGCA
CGGCAACACGGCATTGCTCTTACCGTATCTTCTATCTTCTCAGATGCACGCCTAAGCCACGTCGCAGCTTCCGCT
GTGCCGTTAAAAGATGAAAATGGTGATGGAAACGTGGATCCTTGGGCCTTGATTCCAAAAGAGGACCAGGCTCAG
GTTATCGAGTCGGTCCGCCAACAATGTCGTCTTTCGACAGAGCAAGCCATTGACGACGTATACCCGGCCACGGCG
CTGCAAGAAGGACTGATGGCATTGGCAGCGAAGCAACCTGGTTCTTACGTAGCTCGGTTCACCTTTGAGCTAGGA
CGCGCTGTCGATACGAGCCGTTTCAAAGAAGCCTTTTCGCATACCGTTGCCTCTTGCAGCACTCTGCGCACTCGA
CTTATTCTCTGGCGCGATCAGACAGTCCAGGCAGTCTTGAAGCACAGCGACGTGTGGCCACTGGAAGGCGTGCAG
AAATCTGAAGCCATGGGATATGGCACCCCGCTTTTTTTATATGCGCTTCGAGACAGAGGAAGCAGGCGAGAATTC
CATTTGGCCATGCACCACGCCATTTTTGACGGATGGAGCGTCGGGCTCATCATGCGAACCCTCTCACAGTTCTAC
CACCAGGGCCGCGTGCAAAGACCGCTGGTACCATACGTCAATTTTGTTAAGTATGCCCAATCTCTTGATGGAGAG
CAGGCCAACGAATTTTGGCGAAGCCAGCTCCAAGGAGCCTCAAAAACCACCTTCCCTAAGCGCACTGCCTCCAGC
GCATCTTGCAGCCAAACACTCATACGTCAAATTCATCTGCGCCATCACGTTGGCTCCAATTCCGCCATTACCACT
GCAACGGTTCTGCGTGCAGCTTGGGCCATTGTGCTTGCGAGATACAACGATAGCGCGCCAAATGTCACATTTGGT
GCAGCGGTTGCTGGAAGACAGGCCCCAGTGCCTGGCATTGACGATATAGTTGGGCCTGTTCTCTCTACCGTGCCT
ATGCGGGTTAATCTCGAGGGTACAGAGTTAGTGACCTCCTTCTTGCAGCGCATACAAGCTCAGTCTGTGGATATG
ATGCCGTTTGAACAGTTGGGCTTGCAAAATATTTCTCGTCTTGGGCCCGATGCTAAAAACGCCTGCGACTTTTCC
TCGCTGCTAATCATCCAACACCGAGGCATCTTCCACACTGGCGAAGAATCTCTGCTCGTTGTTCCTGAAGATTGG
TCCGCTTCAACGGGCGGTGGAGAGGCCACATATTTCAACTATCCCATTGTTGTGCAGTGCTTCCTTTTGGAGCAA
AAGGTGATGCTGGAGCTGATCTATGACGACGCGGCAGTGACATCAGATCAGGCGCAGGCAATTGCTTCCCACTAC
ATCAATGTCGTACAGCAATTGATAAAGGCACAAGAGCGCCGTGAGCAGGACCAATTAGTCCTCTCAGACATTTCC
CTATTCGGAGAATGGGACGCAGAGAAGATTCAGGAATGGCACCAGGGGCAGCCGCCTATGGAGACTGTCGACACA
TGTATGCATGACCTGATTTCCAAGACCACTCGGATGCTCCCAGACAAAGAGGCCGTGTTCGCCTGGGATGGAAAG
TGTTCTTATGCCGAGTTGGAGTGCATGACACATAGCCTGGCTCATTACCTGCGCGAACAAGGTGTTGGTCACGAA
TCCCTTGTTCCCATATGCTTTGAAAAGTCGATATGGGCCATTGTGGCCATGCTAGGCATTATGAGGGCAGGTGGT
GCATTTGTGCCACTAAACCCCAATGATCCGTTTGCACGCCGTCAACATCTGGTAGCCAGCCTTCAAGCACCCCTG
ATATTGGCCTCTTGTTCCACGAGTAGCCTCTTTGACGGTATTGGGGTCAATACTGTCGTCATTGCATCGGAATTG
ATCTCATCGCTCCCGACAGCTCAGGTTGAGAGCATTACGACACCGCATAGCGTTGCCTATGTGCTCTTCACATCT
GGAAGTACAGGCGAGCCCAAGGGCGTCATTGTCGAGCATCGATCACTGTGCTCGACTATCTCTCATCGCGGGGAT
GATATTGGTCTGACGGCAGATTGGCGGATTCTGCAATTCTCGAGCTATGTCTTTGATATCAGCGTGTGCGAGATA
TTTGCCTCGTTGGCCCATGGCGCGACGCTGTGTGTCCCGTCAGAGGCGGATAGAGTTAACAGCTTGGCAGGCTTC
ATTAACAAGGCAGAGGTCACGTGCGCCATGCTGACCTCCACTGTAGCCAAACTGCTCACGCCGGCCGACGTTCCC
TCTCTGACGACCTTGCTGCTTGTTGGAGAGGCTCCAACGGTGGAAAACGCCCGAACCTGGGCAGATGCCGTCAAG
CTCTTTAACGATTACGGTCCCGCTGAAGCCTGCATTTTTGTCACGTCGCGCCTCATCCTGCCATCTGCATCTACA
ACAAACATTGGAAGCGGCTGCAATGCGCGCCTGTGGGTCGTCGAGCCAGACGACCACAACCGGCTTGCGCCCGTG
GGTTGTACTGGCCATCTCGTGATCCAAGGCCCTGGTGTAGCCCGTGGCTATCTCAACGATGCTGGCAGAACAGCC
GAGGCTTTCCTCTCAACCACGCCATGGCAGTCGTCAGCCAGCGTGCACAAACTCTACAAGACTGGGGACTTGGTG
CGCTACACTAACGATGGCTCCCTCGAGTACATTGGACGCAAGGATGGCCAGATCAAGCTTCGTGGCCAGAGGCTC
GAGCCGGGAGAAATCGAATACCACATTAAACATCATCTCGGGCCGCAATCGACTTCTTCTGTGCAAATCATCCAT
GGACCAGCCATGGGAGAAGGCGCACTCTTTGCCTTTGTATGCCTTGTGGGCCAAACAGATATGTTGGCTGCCAGT
GAGGGTGACTTGATCTCCACATTCGACGAGGATACGCAGCATCTACTGCAAGACCTAGACGAGGCTCTTCGTGCT
TCCCTTCCGGCATACATGGTTCCATCGCATTATGTGCCTGTTAAGTGGCTACCCGTTACGCCCTCGGGCAAGATG
AACAGCCGCTCTCTGAGAGAGATAGCCCTTTGCTTGCCACCAAGTGATTTGGCTCAATATTCTCTCTCTACCAGA
GCCGAATTTGAGCCGCCTCAAACCCCAATGGAAGTGCACATGGTCGAGCTCTGGGCCGACATCCTCGGCTGTTTG
TCTCAAAACATTGGCCGCAGCGATAATTTCCTTCAAATTGGCGGCGATTCCATCATGGCGATACGACTGGTAGCA
GCTGCCCGCAAGCAAAACATTAACCTGGCCGTTTCAACCATTTTCCGAGATGCGCGCTTGAGTCAAGTGGCTGCT
GCTGCAGAGTTGTCTAGCAATGGGCCAGTTGAGCATGCTGACGTAGAACCATGGAGTCTGCTTCCACAAAATGAC
TCTTCGGCCATCGCAAAATCTGTGCGCCAACAGTGCTTCTTTCCGCCACATGCTGACAATGATGACGATGGCGAC
ATTATTCAAGACGTTTATCCCGCAACACCTTTGCAAGAGGGCTTGATGGCGCTGGCAGTCAAGCAGCCAGGCTCG
TATATGGCTCGTTTCTCATTTAAGCTAGCCGATGATGTCGATATCCATCGTTTCCGAGAAGCCTGGCAAGCTACC
CTCACTGCCTGTGATGTGCTTCGCACGAGACTGGTCTTATTCGGAGAACACACTCTCCAAGCGGTGCTTTGTCCA
CGCGGTCAATGGCAGAATTTGAACACGAAGAATGTTACAATGAGCTATGGCACTCCGCTCTGCAGCTATGCCCTG
GTGGACAATGACACTGGCTTGCACTTTGAGCTTGTGTTACACCACGCTATTTTCGATGGCTGGAGCTTGAAAATC
ATCCTCAGAACCTTACTGACGGCTTATTGCCAGAATGAGTCGCAAAAATCACCAAGACTGCCCCGATATGCCAAC
TTTATCCGCTACTCCCTTACCCTCAACACCAACGAGGCAGAAGAATTTTGGAAGCAACAGCTTAGAGGAGCTGCT
CGGCCAATTTTCCCTAAGCAGTTATTGGCGCAGAATGCAGCTAGCAGCCAGGCCATTACCCGCGAGATGCCTCTG
CGTGCTATTGGTCGCCTTAACATCACTACTGCCACTGTGCTTCGGACGGCATGGGCTATTGTCCTGGCCCGCTAC
AACGATGCAACGAACAACATCACTTTTGGTGCTGCAGTTGCAGGCCGTCAGGCCCCCGTGGCTGGTATCGAGGAC
ATTGTCGGTCCCATTATTTCAACTGTCCCTGTCCGAATCAGCCTCGACCCGGAGCAATCTGTGCATCATTTGCTA
CAAAGAATTCAAGCACAGGCCACAGATATGATGGCTTTTGAGCAATTTGGTCTGCAAAAGATCGCCAAGCTAAGC
CCTGATGCACGGAATGCGTGTGCTTTCTCATCATTGCTTGTTGTGCAACCAGATGCAGTCTTTGGGAAGACATCA
AACTCGGTCATGGTCTTGGAGCCTGGCAATGACAACAAAAACGCTGCTTCTCCCCTTGCCGAATACTTTAGTTAC
CCGCTGGTTTGGCAATGCCATGTGACAGATTCCGCTATACACTTGCATGCCATTTTCGACTCTTCGGTATTAAGC
AAGCAGCAAATAAACGCCATGGCCGAACAGTTCTGTCATGTTGTACAGCAACTATGCAACGCTGAAGCAGAGCCT
GCTAACAAAACTCGAACAAGGGATATCTCTCTTAGTGGTCCCTTCGATCTGGCTCTTGCTCAAGAATGGAATGAC
GCCGTGGATACCAAGGTCATTTCCGACACCCTGCATGCCCAATTTGAGAAGCAAGCAAAACGACGTCCGGGCGCG
CCTGCCATCTTTGCATGGGATGGCTGCCTATCATATAGAGAGTTGGATACAGCTGCTGATCACCTGGCACAACTG
CTTAGACAACAATACGGTGTTGGGCCAGACGACCTTGTACTGGTCTGTTTTGAGAAATCCATCTGGTTCTACGTC
GCTATTCTTGCCATCAATAAAGCTGGCGGTGCTTGGGTTCCCATCGACCCTAGTCATCCAGCACACAGGCACAAA
AAGATAGCTGACCAAGCTAGCGCCTCTCTTGCCCTGGCGTCCGCCACGGCAGCCGCGTCATGTATAGGACTTGTC
AAGAATGTAGTGCAGGTTTCATCAGCACTTCACGAGGAGCTTTTATTGAAGCCTCTCGAAATGCCTGCGGTCGAG
GTTTTGCCCCATCACGCGGCATATGTCTTGTTCACATCTGGCACTACGGGGACTCCCAAGGGTATTATCATGGAA
CACGGCTCGCTTTGCACGAGTCAAACAGCTATTAGCCGCCGGCTTAATCTCGATGAAAACGTGAGGATGCTTCAG
TTCGCGGCCTACGTGTTCGATCTGAGCATAGGCGAAATGATTGCTCCCTTGATCTCCGGAGCTTGTCTGTGTGTG
CCCGCAGAACATCATCGCAAAAGCTTGACCGATTTGTCAGTGTTTATGCGCGAGGCAAGAGTCAACTGGGCATAT
TTGACTCCTTCATTTGCCAGGCTTATCGATCCAGACACTATGCCTGGATTAGAGCTTCTTCTTCTGGCTGGCGAA
GCTGTTGGCAAAGACTTGCTCGAGACATGGGCTAGTCGTGTTCGACTAGTCAATGGCTGGGGGCCATCCGAGACT
TGCTGCTTCAGTTCATTAAATGAATGGGATAGTGCTTCGCAATCTCCCCTCAATATCGGATACCCCGTCGGCGGT
CGATGCTGGATTACAGAACCCGACAATCACCATCAACTGGCTCCTATTGGATGTGTGGGCGAGGTTTTGATCCAA
GGGCCCACAATTGCCCGAGAATACCTCGATTATGCTCAAGGAACACGAATGAACTTCATCACGCAAGATCTGCCT
GGGTGGGCTCCCGATCAAGATTTAGCTCCGTACTCGAGGCTTTACAAGTCTGGAGACTTGGCCTACTATAATCCA
GATGGCACGCTCGAATTTGTGGCCCGCAAGGATACCCAAGTCAAAGTCTCGGGCTTCCGCGTGGAGCTGGTGGAA
ATTGAGCACTATATACGTCAAGGACTTGGCGGCGTTGAGCAAATCATTGTCGACGTGGTTGAATCTAGGGCTTCA
TCCAAGCCCAGACTGGCTGCCTTTGTGTGCTTCTCTTTAGCAACGTCAGCACCAAGTCATGACTTGGACGAAAGT
GACTTGCTGCTTCCGCTCGATGCGGCACTTACTCGACAGCTGTCTGAGCTCAAGGGCTATTTGCAAGCTAGGGTA
CCAGCTTATATGGTGCCAAGCATCTATATACCCGTTAGGCCCAATCTACCAGATCATATGCTTACACAATACATG
TTGGCTGATATGCAGAAAGAATCGCCAACGACGTATCAAGAAGCAATGATGCAAGGGCTTTGGGCAGATGTGTTG
CACATATCTCCTGATTTGATTGGTCGCAGTGACAGCTTCCTACTTTTAGGAGGCGACTCGCTGGCTGCGATACGT
CTAGTAGCCAGAGCTCGAGAGAAAGGAATTCGCGTCTCCGTGGCATCCATCTTTAGTGATCCACGTCTAAGCCAA
GTAGCTGGTGCTGCGTCCTTCGAGCAGTTTGAACACACCATGGTCGAGCCTTGGAGTCTCATCTCAACAAACGAA
CGTGCCTCGCTTATTGAAGTTGCCCGCAAGCAATGTTCGCTGGCCCCTAACGATGTTATTTATGACATTTATCCC
ACAAGTGCTTTACAAGAAGGTTTAATGGCATTGGCGACCAAGCAGTCAGGTTCTTACATGGCTCGATTCACTTTT
GACCTGGACGATATGATAGACTTGAATCGCTTCAAAGAGGCGTGGCAATATACGCTCGAGGCCTGCGACGCTTTA
CGTACGCATATCATCTTGCATGGCGCCACGACACTGCAGGCCGTTGTTCACCAAGAGCAAGCAATTCAGTGGAAG
CAGGATGGGCTGGGAGCCTTGAAGATGGAATACGGAACACCTCTGTGCGAGTATGCACTCAATCAACATTCCAGT
CCTAAACGCTTCGAACTCGCCCTTCATCACGCTATTTTCGATGGATGGAGCTTCGGCCTGATTATGCGTACTCTT
TCCGAGTCGTATCATGGAGCAAAAATAACTCCCTTGTTCCCCTATGCCAGCTTTGTCAAGTATGCCAAATCCATC
GATATTAAATCTGCTAGTGACTACTGGCGGGAACAGTTAAACGGCGCGACACGACCCGTCTTTCCCAGGAGTTCA
ACAACATCGGGTGAATCCTCCAGTCAAAGCTTTGCTCGAGAGATTCCCGTTCCCCAGGGCAAACCAGGCGTTACC
GTTGCCACCGTGCTTCGCGCTGCTTGGGCCATAGTACTTGCTCGATATAACGACGATGTATCCGACATCACTTTT
GGCGCGGCCGTTTCAGGCCGTCAGGCGCCTGTGGAGCATATTGAAGACATTGTTGGACCCGTTATATCAACAGTA
CCGATACGTGTCAAATTACTAAAGGAATGTCGGGCCAGCGACTTTTTGCAAGGCCTACAGCGCCAGGCTGCGGAA
ATGATGGCATTTGAACAGATGGGCCTGCAAAATATCAATAAATTGGGGACAGATGCGAAAAACGCGTGCGACTTT
TCGACTTTGCTCGTCATTCAGCCCCGTGCCATTTTCAGAGAGCTGTCGCATTCCTTCATGTCCATGACACAGGAA
GATGGCCAGGGCGCAAGTTTGTCCGAGTATTTCAGCTATCCTCTGGTTTGGCAGTGCCATGTCTCGGAACAAGGA
AAAATTCACTTGTACGCAATTTTCGACACGAATGTGCTCAGTGAGGCCCAAATCAACATCATGGCTGAGCAATAT
TGCCATGTTATCCACCAGCTATGGCTTGCCGACAACAGCCAAATTCTTCTCAAGGACGTCTCGCTCTGCAGTCCT
TACGACATGAATCTTGCCCTGACGTGGAGCGCCCCTTCGGAAACGCTGCCAGTTCGAGAAACTTTCCATTCTCTT
GTTGAGCGGCAGGCAAAGGCTCAACCTAATGCTCCGGCGATATACGCGTGGGACGGTGAATTGTCGTATGGCGAG
CTCTACGCCGCGGCAGACCGGTTGTCTAGGCTTTTGACACACAAACTGGGGGTTAAACTAGAAGAGCGGGTTATT
GTGTGCCTCGAAAAGTCACTCTGGTTTTATGTTGCGATACTAGCCGTCAACATGGCTGGCGGTGTTTGGGTTCCG
TTTGATCCCTCTCATCCACGGGACCGTCACAACAAAATTGCAAGCCAAGCGGGGGCTCGAATTGCGCTCACCTGG
CCAGACAACGAACAGAAACTGCAGGGACTCGTTGAACACATTATTCAACTATCTGCCGACTTGGACCAAGAGCTT
TTACTTGACGCTAACAAGTATCCTCCAGTCTATGTTCAAGTGGAGCCAAGCAACGCGGCGTATATTCTTTTTACA
TCAGGCACCACGGGAACGCCCAAGGGCATTGTTATGGAGCATGGAGCTCTATGCACTAGTCAGATTGCTATTGGA
AAAAAGCTCGGCATGGGCACGGATGTACGGCTACTGCAATTTGCAGCATACGTGTTCGATCTTAGTATCGGCGAG
ATGATCGGCCCCCTTGTCGCAGGTGGCTGCCTATGCGTTCCTTCAGAGCACGATCGAATGAATAACCTAGGTGGC
TTCATAAGTCAAGCTCGCGTCAATTGGGCGTACCTCACGCCATCCTTTGCAAGACTTATCGAGCCGACAAGTGTG
CCCGGGCTTGAATTGCTACTATTGGCAGGAGAGCCTGTAGGCAAGGACCATTTGAAATCGTGGATTGGCCGCGTG
CGGCTTATCAATGGTTGGGGTCCCTCGGAAACATGTTGTTTCAGCTCGCTTCAGGAATGGGATTCTATTGATCAA
TCACCGTTAACTATCGGGCGCTCTGTCGGGGCACGCTGTTGGATAGTTGAGTCGGACAACTTGGAAAGGCTCGCG
CCGATTGGGTGTATAGGAGAGATTGTTATTCAAGGCCCGACTATTGCTCGGGAGTATCTTGCCAATGATGAAGGC
ACCCGAGCCAGCTTCGTGGAACGACTTCCCTCGTGGGCCCCAGATGCGCCAGGACATCGTCGGTTATACAGGTCA
GGAGACCTGGGGTATTACAATGCGGATGGAACCATGGAATTTGTGTCGCGCAAGGACACGCAGGTCAAGGTGCGG
GGATTCCGTGTTGAGTTGGGTGAGGTGGAGCATCACATACGGCAAAGCCTCCGCGAGGCGCACCAAGTTGTCGTG
GACGTTCATCAGGACTCGACAAAGCTCGTCGCATACGTCTGCTTTTCTTCGGAAACGTCGAATAGTTCAAACAGC
TCGGACATGATTCGTCCCATGGACTCGAGCCTCGCTGCCAAGTTTTCGGAACTCAAGAGCTATCTAGGCGTCCGG
TTGCCAGAGTACATGATTCCTGCCGTTTATGTGCCGCTCAAGTTTGTTCCTTTTATTACGTCACAAAAGATTGAT
CGCGCAGTCCTACGCGATGCGACGTCTCCCGCCAACATGAAAGGCGATGACTTGGCCCGGTACATGCTTGCCGAC
ACAAGTAAAGAAACTCCTGCAAGTGAGCGAGAGATTACAATGCAGAAGCTATGGGCAGACGTCCTGCGAGTCTCT
ATTGAACTCATTGGACGTCACGATAGCTTCCTCCAGCTTGGTGGTGACTCTCTTGCCGCCATACGCCTAGTCACG
CAAGCTCGTAAACAAGGGATTCAGTTAACGGTGGCACAAATATTCCGCGATCCACGTCTCAGCCAGGTCGCGGCA
GTGGCACAATTTGGGGAAAGTATAGAGGAGACCTCCTCTGTGCAGCCCTGGAGCCTGATTTCCTCTAGCAGACGA
GGCACAATGAGGACAGTAATCCAAAGACAGTGTAACCTGAGGAGCGCAGACGAAATCTTGGACGTGTATCCAGCT
ACAGCTCTCCAGGAGGGACTCATGGCTTTGACGGCTCGACAACCTGGTGCGTACGTGACGAGATACATTTTCCAG
ATAGGCCACGACGTCAACGTGGACCGCTTCAAGACTGCATGGGAACAAACAGTGCAAAGCATAGATGCTCTTCGA
ACACGCATTGTTTTCCATGGCGGCAAGACATGGCAGGCAAAACTGGACCAGGGCGCTGAGTGGCTGCCGACGCAG
AGGTTTTCGAAATACAAGACGCCGATAGAAGCATTGGCCATGGGCTATGGAACCCGGCTATGTCTTTATGCACTC
GTTGATGGCGATTCAGGCGACAAGTACTTTGCCCTGACTATGCATCATTCCATTTACGATGGATGGTGCCTTCAG
CTCATCGCGCAGACGATAAAGCACTTTTATGACGCGAACCCTAGTCCTATCGGTTTGGCTCCCTATGCCAATTTC
ATCGACTTTACCCTGCGTCTAGATCTTAAGGCGGCCGCTGCATTTTGGAAGAAGCAGCTGGGCGGAGCGAAACGC
ACTATTTATCCGCAAATGGTCAAGAAGCCCAAGTTAAATTCTGAAACGTCTGGCAAGACACTCTGCTACGAAATC
ACGCTGCGCAAGTCTGCTGGAACCGTCACCATGGCAACAGTATTGAGAGCAGCATGGGCAATCGTTCTTGGACGC
TACAACGATGATGCCGACGATGTCACATTTGCCTCTACTGTGACGGGCCGGCAGACGCCAGTATCAGGTGTGGAC
CGCATGGTTGGACCAGTCATCTCAACGGTGCCCGTGCGAGTCAAATTGGACAAGACACAGAGCGTTGGCCAGTTT
CTCCACAGTGTGCATCTCGACGCAGCAGAAATGATTCCTTTTGAGCAGATGGGCTTACAAAACATTGCAAAGCTT
GGAGTCGAGATGCGAGAGGCATGCAACGTGTCGACATTGCTCGTGGTGCAGCCCGAAGAGCTCTTTGAACAATCG
ACCAATGGACTCCTCTCGTCTCAACCAACAGAAGCCGATGCCCTATTCAAAGGCTACTTCAACTACCCGCTCGTG
GCTCTAATATATCTCCGTTCTGATTGTGCCTTTTTGAACCTCATATACGACGCGTCGGCCATTTCAACGGCGCAG
GTGAATCGCATGGCCAAACAATATGAACATGTGGTGGAACAGCTGCTGGCTTATGGCGATGATTCAAGCCGCACC
GTCGACGATATCAACCTCTGCAGCACGGCGGACATGGACCAAGTCCTGCAGTGGCACGATGCTCTTGAACCAATG
GATATCACAAACGCCTGCGCACACCAGTTAATTTCCCAAACTGCAGCGCAGACTCCTGATCAAGAGGCCATCTTT
GCATGGGACGGAACATGTACGTACGGCGAGCTAGACCGTATGGCTACTCATCTGGCCAGTTTCTTGGCTTGCCAA
GGTGTTGGTCCTGAATCTCTTGTTCCCGTGTGCTTCGAAAAGTCCATGTGGATCGTCGTTGCCATATTGGCCATT
CAAAAGGCGGGTGGCGCGTATGTGCCGCTCAGTCCAGAGCATCCTCTCCTGCGACGCCAACAACTGGTGGCCAAA
ATCAAGGCTCCTCTGCTGCTTACATCTATAGCGGCAGAGAGTGCTTGTCAGGGCATCCAAGTCCCGATTGTAGTT
GTGTCTCGCGACACAATTGCAGGCTTGTCGGACAAAACGCAGCATGGTGCAGCTGAGAGTGTTTGCAACCCCAAC
AACGCAGCATATGTTCTCTTCACCTCTGGAACGACGGGAGAGCCCAAGGGCGTGGTGGCTGAGCACAAGGCGCTC
GTATCCGGACTTTTCCACTTTGCCCGAAAAACTGGTCTTTCGTCAGCTACACGAATGCTTCAGTTTTCAAACTAC
ATCTTTGATGTTAGTGTGAGCGAAATCTTTGGTACGCTGCTCCATGGCGGATGTATCTGTATCCCGTCAGAGGCG
GAGCGCATGGACAATATCGAAACATTTGTCAACCGGTCGCGCGCCAACTTTGCCATGGTGACTCCCTCTTTTGCT
GGTACACTATCACCAGCCAAGATGCCAACGCTAGAAGCCATGATCTTAGGTGGTGAAGCGCTTACCATGGACAAC
ATACAGACCTGGGCCAGCAAAGTGCGCTTGTTTAATAACTATGGCCCAGCCGAAGCCGGCGTCTCGACGAGCCAG
CATTTGGTAGAGCCAGGAAGCAGCGAGCCCAGCATTGTGGGTAGCGGCTGCAACAACCGTCTCTGGATCATTGAG
CCCAGCAACTCAGACCGCCTAACGCCTATTGGCTGCGTCGGCGAACTCGCCGTTCAAGGGCCATGCGTCTCTCGT
GGCTATCTCGAAGACGAGACGCGGACCAAGGCTTCTTTCCTCGAGTCGCCTTGCTGGCTGCCGAGCGGTGCGGCG
CATCGGCGCGTGTACAAGACGGGAGACTTGGTGCGGTATAGTGATGATGGCAGCGTGGTCTTTGTTGGGCGCAAG
GACGGGCAAATTAAGCTTCGTGGGCAGCGGCTGGAGCCGGGCGAGATTGAGTATTGGATCAAGAAGAGTTTGGGA
CAGAGGCACACCGTTTCTGTGCAGCTTATGCATGGGGTTGATGCGGGTGCATCGTTGGTGGCTTTTGTGTGTGCG
CCCCCGGAAGAGTGA
Transcript >OphauB2|2027
ATGGTGCCGTCTTACTATTTGCCCGTTGCGCATCTTCCACTCAGTCTTTCTGGCAAAGTCGACGCCCAAAAGCTA
CGCGAATGGGCCGAACAATTATCAGCCCACAACCTTGTAGAGTATTCCGTCGCTGAACGAACAGAATATGAGCCT
CCGACAACAGACATAGAAAAGAAGCTTCAGCATCTCTGGGCATCAGCCTTGGAAATACCTATAGAGACAATTGGT
CGCAATGAAAGCTTTCTCGCACTGGGCGGCGACTCCATCGCGGCTATTCGCCTCGTGGCGGCTGCTCGAAGCCAA
GACATTACTCTTTCCGTCTCGTCCATCTTCAAACACCCCCAGCTGTCCCAGATGGCCTTGTCCGCCCGCCTCGAA
AAGGTGGTACAAGATGAGGCTTTGGAGGCATGGGGCATGATTGCGCAGGACGAGCGACAATCGATAGAGGACAGC
ATTCGAGAGCATTGTCAACTATCAGCACAAGATATCATTGAAGATGTCTATCCGGCGACACCGTTGCAAGAGGGT
CTCATGGCGTTGGCCGTGAAGCAGCCTGGTTCATACATGGCCACCTTTACATATCGACTTGCAGACGACGTCGAC
GCCGAATATTTCCAGAAAGCCTGGGAGACAACCCTGCAAGTCTGTAGCGTGCTTCGGACTCGAATTGTTGTTCAT
CGTGACCGAACTCTTCAAGCCATAGTTAAAACACCCCAAAAGGATTGGCTAAACGAGAAGAATAGTTGCTCGCGC
CACATGCAATACGGCACGCCACTATGCTACTCGTCTCTTGAGCGCGGCACTGACACCTCCTTGTTCCGTCTAACA
ATGCACCACGCAATATTTGATGGCTGGAGTTTTGGTCTCATTATGCGCACGCTGTCACAAGCCTACAGCGGCGCG
GCCAAACCCGATTTGTCTTTGCCTCATTATGGCAATTTTGTCAAGTATGCTCTTTCGCTCGACAAGTCTGACGCT
GCAGAATACTGGTCTAGCCAGCTCAAGGGCGCTACACGACCAATGTTTCCTGCGCGCCAGACGGCCAAATCGCCG
AAGCCGGCAAGCGCAACATTAACCTGCCACATACCGCTCGATACAGGGCGCCAGTTGCCCGTCACCAAGGCCACC
CTTCTCCGAGCTGCATGGGCTGTTTTAATGGCGCGATACAACGACACAGACGACATTTCTTTTGGAGCTGCAGTC
GCTGGGCGGCAAGCCCCCATCTCCGGTATCGAGGAAATAGTTGGCCCAGTCCTCTCGACCGTTCCGGTGCGAGTC
AAAGTTCCTGGCCAGCAGTCTATTAGTGACTTTTTGCAAACGCTACAGACACAAGCAACTGACATGATTCCATTC
GAGCACATGGGGCTGCAAAATATTGCCAAGCTGGGACTAGACGCGCGAGAAGCCTGTGACTTTTCTTCCATGTTT
TCGGTGCAGCATAACACAATTGCAAGCAAGGGAACGTCTTCATTGCTCATCTCAATTGTCAATACCTCCCCTGAT
ACCGCGCTCAACTTTGCTACTTACTTTACTTATCCGCTTGTCGGGCAATGCTTCCTCTCAGAGCATGAGGCCTCC
TTGGAGCTAATCTACAACTCCGCGTCACTCTCTTCTCAGCAGGTAGAGGGCCTGGCTGCTCAGTACTGTCATGTG
ATTGAGCAGCTGGTTACCCATATCACGGAAGCCAAGGAGACGCCACGGCTTAAAGACATTGAGATTTTCGGAGCG
TGGGACAAGACGCAGATTGAGCAATGGCATAGTCTTCAAGAGCCAGTCACCATGCTTGGCACCACCGTCTTGGAG
CTGCTCTCTACAGTTTCGACGAAATCACCAGATGACGAAGCCATTTGCGCATGGGACGGCAGCTGCACATATGCC
GAGCTAGAAAATATGACAACTGACTTGGCAAGTCACCTGCAAAGCCTTAAAGTCGGCAAGGGCTCGCTGGTTCCA
ATTTGCTTTGAAAAGTCCTTATGGACAGTAGTTGCTAAGATGGCCATCTTGAAGGCCGGCGCTGCCTTTGTCCCA
TTGAACCCCGATCATCCTTTGACCCGGCGAAAGCAGCTTGTGGACGTTCTCGAATCACCTCTGATTCTTGTTTCT
GAAGCTACGCAGCAATCTTGTCAAGACATGAACCTGCCACTTGTTACTATCTCAGAGGCCTGCGTGTCGAGACTA
CCCCAATGCACTTCGAAGCGAGATTATCCCAGCTCACAAGACACAGCATATGTTCTGTTTACCTCTGGCAGTACA
GGTGAGCCCAAGGGAGTTGTTGTGAGCCACGGTGCCCTAGCATCTTGCGTGCTCTCTCATGCACGGGATATTGGT
GTCCAGCCCGAGAGCCGAGTGCTACAATTCTCGGCCTATACTTTTGACATTAGTCTAGCAGAGACACTTTGCACT
CTTTGTTTTGGAGGCTGCTTGTGCATTCCGTCAACCGAGGAGCGTCTAAGCAGCTTGACAGCTTTTGTGCGAGAC
CGCCGGATAAACGTCACCATGCTCACGCCAACGATGCTATCAACAATATCTCCCCAAGAAATTCCTGGCGTTGAT
ACCGTCGTCCTCGTCGGTGAGCCAAGTACGCAGTCAACTTTGGATACTTGGTCAGACAAGGTGACTCTTATCAAC
AACTACGGGCCCAGTGAGGCTTCAATCAATACTAGCAGTCATCTGATTCTTCCGGGCCAAAAATCACCGCGAATG
ATTGGATCTGGATGCAACTCACGTCTTTGGATTGTCGAGCCTGATAATACCGAGTCTTTAGCTCCGGTTGGGTGT
GTTGGAGAGCTTGTGATTCAAGCAGCATCTATTGCCGATGGTTACCTAAACGACGTAAAACGGTCCAAAGAATCG
TTCATTCAAGCCCCTTCATGGCTTCCACAAGGGACTCTTCCAAAGCTATATAAGTCTGGAGATCTTGTGCGCTAT
CATAACGATGGAACACTGGAATATGTGGGGCGTAAAGATGGTCAGCTCAAGGTTCGTGGACAGAGACTTGAATCC
GGCGAAGTCGAATACCACATTAAACAGATACTTGGCCCACGATCAACCTCATCAGTTCAACTCATCCAAGGAGAA
AACGTTGGCGGCAAGGCCCTAGTGGCTTTTGTCTGTCTATCGGGTAGCACCCGCTGCATCGATGATGGCGAATGT
CACTCATTGTGGGCAAGAGACGACAACACATTCGATCTTCTCTTTAGCCTCCACCAGAGTCTCCGAAGTGTTTTG
CCTGACTATATGGTGCCTTCCTACTTTCTCCCAGTCGCATACCTCCCCGTAACATCTTCGGGCAAGACAGACGGG
CGAACAATTCGAACATGGGCTTCTACCATAGAGCGAGACGACATGGCGCAATTTTCCCTTTCTTCAAGTGTGCCA
TTTGTTCCGCCAACGACAGCCATGGAAAAGAAGCTTCAGGGGATGTGGGCAGACGTCCTTGGGATACCAGCGGAG
TCGATTGGCTGCGAGGATAACTTTCTTGATCGAGGAGGCGATTCCATTGCAGCTATTCACTTGGTCTCAATGGCA
CGGCAACACGGCATTGCTCTTACCGTATCTTCTATCTTCTCAGATGCACGCCTAAGCCACGTCGCAGCTTCCGCT
GTGCCGTTAAAAGATGAAAATGGTGATGGAAACGTGGATCCTTGGGCCTTGATTCCAAAAGAGGACCAGGCTCAG
GTTATCGAGTCGGTCCGCCAACAATGTCGTCTTTCGACAGAGCAAGCCATTGACGACGTATACCCGGCCACGGCG
CTGCAAGAAGGACTGATGGCATTGGCAGCGAAGCAACCTGGTTCTTACGTAGCTCGGTTCACCTTTGAGCTAGGA
CGCGCTGTCGATACGAGCCGTTTCAAAGAAGCCTTTTCGCATACCGTTGCCTCTTGCAGCACTCTGCGCACTCGA
CTTATTCTCTGGCGCGATCAGACAGTCCAGGCAGTCTTGAAGCACAGCGACGTGTGGCCACTGGAAGGCGTGCAG
AAATCTGAAGCCATGGGATATGGCACCCCGCTTTTTTTATATGCGCTTCGAGACAGAGGAAGCAGGCGAGAATTC
CATTTGGCCATGCACCACGCCATTTTTGACGGATGGAGCGTCGGGCTCATCATGCGAACCCTCTCACAGTTCTAC
CACCAGGGCCGCGTGCAAAGACCGCTGGTACCATACGTCAATTTTGTTAAGTATGCCCAATCTCTTGATGGAGAG
CAGGCCAACGAATTTTGGCGAAGCCAGCTCCAAGGAGCCTCAAAAACCACCTTCCCTAAGCGCACTGCCTCCAGC
GCATCTTGCAGCCAAACACTCATACGTCAAATTCATCTGCGCCATCACGTTGGCTCCAATTCCGCCATTACCACT
GCAACGGTTCTGCGTGCAGCTTGGGCCATTGTGCTTGCGAGATACAACGATAGCGCGCCAAATGTCACATTTGGT
GCAGCGGTTGCTGGAAGACAGGCCCCAGTGCCTGGCATTGACGATATAGTTGGGCCTGTTCTCTCTACCGTGCCT
ATGCGGGTTAATCTCGAGGGTACAGAGTTAGTGACCTCCTTCTTGCAGCGCATACAAGCTCAGTCTGTGGATATG
ATGCCGTTTGAACAGTTGGGCTTGCAAAATATTTCTCGTCTTGGGCCCGATGCTAAAAACGCCTGCGACTTTTCC
TCGCTGCTAATCATCCAACACCGAGGCATCTTCCACACTGGCGAAGAATCTCTGCTCGTTGTTCCTGAAGATTGG
TCCGCTTCAACGGGCGGTGGAGAGGCCACATATTTCAACTATCCCATTGTTGTGCAGTGCTTCCTTTTGGAGCAA
AAGGTGATGCTGGAGCTGATCTATGACGACGCGGCAGTGACATCAGATCAGGCGCAGGCAATTGCTTCCCACTAC
ATCAATGTCGTACAGCAATTGATAAAGGCACAAGAGCGCCGTGAGCAGGACCAATTAGTCCTCTCAGACATTTCC
CTATTCGGAGAATGGGACGCAGAGAAGATTCAGGAATGGCACCAGGGGCAGCCGCCTATGGAGACTGTCGACACA
TGTATGCATGACCTGATTTCCAAGACCACTCGGATGCTCCCAGACAAAGAGGCCGTGTTCGCCTGGGATGGAAAG
TGTTCTTATGCCGAGTTGGAGTGCATGACACATAGCCTGGCTCATTACCTGCGCGAACAAGGTGTTGGTCACGAA
TCCCTTGTTCCCATATGCTTTGAAAAGTCGATATGGGCCATTGTGGCCATGCTAGGCATTATGAGGGCAGGTGGT
GCATTTGTGCCACTAAACCCCAATGATCCGTTTGCACGCCGTCAACATCTGGTAGCCAGCCTTCAAGCACCCCTG
ATATTGGCCTCTTGTTCCACGAGTAGCCTCTTTGACGGTATTGGGGTCAATACTGTCGTCATTGCATCGGAATTG
ATCTCATCGCTCCCGACAGCTCAGGTTGAGAGCATTACGACACCGCATAGCGTTGCCTATGTGCTCTTCACATCT
GGAAGTACAGGCGAGCCCAAGGGCGTCATTGTCGAGCATCGATCACTGTGCTCGACTATCTCTCATCGCGGGGAT
GATATTGGTCTGACGGCAGATTGGCGGATTCTGCAATTCTCGAGCTATGTCTTTGATATCAGCGTGTGCGAGATA
TTTGCCTCGTTGGCCCATGGCGCGACGCTGTGTGTCCCGTCAGAGGCGGATAGAGTTAACAGCTTGGCAGGCTTC
ATTAACAAGGCAGAGGTCACGTGCGCCATGCTGACCTCCACTGTAGCCAAACTGCTCACGCCGGCCGACGTTCCC
TCTCTGACGACCTTGCTGCTTGTTGGAGAGGCTCCAACGGTGGAAAACGCCCGAACCTGGGCAGATGCCGTCAAG
CTCTTTAACGATTACGGTCCCGCTGAAGCCTGCATTTTTGTCACGTCGCGCCTCATCCTGCCATCTGCATCTACA
ACAAACATTGGAAGCGGCTGCAATGCGCGCCTGTGGGTCGTCGAGCCAGACGACCACAACCGGCTTGCGCCCGTG
GGTTGTACTGGCCATCTCGTGATCCAAGGCCCTGGTGTAGCCCGTGGCTATCTCAACGATGCTGGCAGAACAGCC
GAGGCTTTCCTCTCAACCACGCCATGGCAGTCGTCAGCCAGCGTGCACAAACTCTACAAGACTGGGGACTTGGTG
CGCTACACTAACGATGGCTCCCTCGAGTACATTGGACGCAAGGATGGCCAGATCAAGCTTCGTGGCCAGAGGCTC
GAGCCGGGAGAAATCGAATACCACATTAAACATCATCTCGGGCCGCAATCGACTTCTTCTGTGCAAATCATCCAT
GGACCAGCCATGGGAGAAGGCGCACTCTTTGCCTTTGTATGCCTTGTGGGCCAAACAGATATGTTGGCTGCCAGT
GAGGGTGACTTGATCTCCACATTCGACGAGGATACGCAGCATCTACTGCAAGACCTAGACGAGGCTCTTCGTGCT
TCCCTTCCGGCATACATGGTTCCATCGCATTATGTGCCTGTTAAGTGGCTACCCGTTACGCCCTCGGGCAAGATG
AACAGCCGCTCTCTGAGAGAGATAGCCCTTTGCTTGCCACCAAGTGATTTGGCTCAATATTCTCTCTCTACCAGA
GCCGAATTTGAGCCGCCTCAAACCCCAATGGAAGTGCACATGGTCGAGCTCTGGGCCGACATCCTCGGCTGTTTG
TCTCAAAACATTGGCCGCAGCGATAATTTCCTTCAAATTGGCGGCGATTCCATCATGGCGATACGACTGGTAGCA
GCTGCCCGCAAGCAAAACATTAACCTGGCCGTTTCAACCATTTTCCGAGATGCGCGCTTGAGTCAAGTGGCTGCT
GCTGCAGAGTTGTCTAGCAATGGGCCAGTTGAGCATGCTGACGTAGAACCATGGAGTCTGCTTCCACAAAATGAC
TCTTCGGCCATCGCAAAATCTGTGCGCCAACAGTGCTTCTTTCCGCCACATGCTGACAATGATGACGATGGCGAC
ATTATTCAAGACGTTTATCCCGCAACACCTTTGCAAGAGGGCTTGATGGCGCTGGCAGTCAAGCAGCCAGGCTCG
TATATGGCTCGTTTCTCATTTAAGCTAGCCGATGATGTCGATATCCATCGTTTCCGAGAAGCCTGGCAAGCTACC
CTCACTGCCTGTGATGTGCTTCGCACGAGACTGGTCTTATTCGGAGAACACACTCTCCAAGCGGTGCTTTGTCCA
CGCGGTCAATGGCAGAATTTGAACACGAAGAATGTTACAATGAGCTATGGCACTCCGCTCTGCAGCTATGCCCTG
GTGGACAATGACACTGGCTTGCACTTTGAGCTTGTGTTACACCACGCTATTTTCGATGGCTGGAGCTTGAAAATC
ATCCTCAGAACCTTACTGACGGCTTATTGCCAGAATGAGTCGCAAAAATCACCAAGACTGCCCCGATATGCCAAC
TTTATCCGCTACTCCCTTACCCTCAACACCAACGAGGCAGAAGAATTTTGGAAGCAACAGCTTAGAGGAGCTGCT
CGGCCAATTTTCCCTAAGCAGTTATTGGCGCAGAATGCAGCTAGCAGCCAGGCCATTACCCGCGAGATGCCTCTG
CGTGCTATTGGTCGCCTTAACATCACTACTGCCACTGTGCTTCGGACGGCATGGGCTATTGTCCTGGCCCGCTAC
AACGATGCAACGAACAACATCACTTTTGGTGCTGCAGTTGCAGGCCGTCAGGCCCCCGTGGCTGGTATCGAGGAC
ATTGTCGGTCCCATTATTTCAACTGTCCCTGTCCGAATCAGCCTCGACCCGGAGCAATCTGTGCATCATTTGCTA
CAAAGAATTCAAGCACAGGCCACAGATATGATGGCTTTTGAGCAATTTGGTCTGCAAAAGATCGCCAAGCTAAGC
CCTGATGCACGGAATGCGTGTGCTTTCTCATCATTGCTTGTTGTGCAACCAGATGCAGTCTTTGGGAAGACATCA
AACTCGGTCATGGTCTTGGAGCCTGGCAATGACAACAAAAACGCTGCTTCTCCCCTTGCCGAATACTTTAGTTAC
CCGCTGGTTTGGCAATGCCATGTGACAGATTCCGCTATACACTTGCATGCCATTTTCGACTCTTCGGTATTAAGC
AAGCAGCAAATAAACGCCATGGCCGAACAGTTCTGTCATGTTGTACAGCAACTATGCAACGCTGAAGCAGAGCCT
GCTAACAAAACTCGAACAAGGGATATCTCTCTTAGTGGTCCCTTCGATCTGGCTCTTGCTCAAGAATGGAATGAC
GCCGTGGATACCAAGGTCATTTCCGACACCCTGCATGCCCAATTTGAGAAGCAAGCAAAACGACGTCCGGGCGCG
CCTGCCATCTTTGCATGGGATGGCTGCCTATCATATAGAGAGTTGGATACAGCTGCTGATCACCTGGCACAACTG
CTTAGACAACAATACGGTGTTGGGCCAGACGACCTTGTACTGGTCTGTTTTGAGAAATCCATCTGGTTCTACGTC
GCTATTCTTGCCATCAATAAAGCTGGCGGTGCTTGGGTTCCCATCGACCCTAGTCATCCAGCACACAGGCACAAA
AAGATAGCTGACCAAGCTAGCGCCTCTCTTGCCCTGGCGTCCGCCACGGCAGCCGCGTCATGTATAGGACTTGTC
AAGAATGTAGTGCAGGTTTCATCAGCACTTCACGAGGAGCTTTTATTGAAGCCTCTCGAAATGCCTGCGGTCGAG
GTTTTGCCCCATCACGCGGCATATGTCTTGTTCACATCTGGCACTACGGGGACTCCCAAGGGTATTATCATGGAA
CACGGCTCGCTTTGCACGAGTCAAACAGCTATTAGCCGCCGGCTTAATCTCGATGAAAACGTGAGGATGCTTCAG
TTCGCGGCCTACGTGTTCGATCTGAGCATAGGCGAAATGATTGCTCCCTTGATCTCCGGAGCTTGTCTGTGTGTG
CCCGCAGAACATCATCGCAAAAGCTTGACCGATTTGTCAGTGTTTATGCGCGAGGCAAGAGTCAACTGGGCATAT
TTGACTCCTTCATTTGCCAGGCTTATCGATCCAGACACTATGCCTGGATTAGAGCTTCTTCTTCTGGCTGGCGAA
GCTGTTGGCAAAGACTTGCTCGAGACATGGGCTAGTCGTGTTCGACTAGTCAATGGCTGGGGGCCATCCGAGACT
TGCTGCTTCAGTTCATTAAATGAATGGGATAGTGCTTCGCAATCTCCCCTCAATATCGGATACCCCGTCGGCGGT
CGATGCTGGATTACAGAACCCGACAATCACCATCAACTGGCTCCTATTGGATGTGTGGGCGAGGTTTTGATCCAA
GGGCCCACAATTGCCCGAGAATACCTCGATTATGCTCAAGGAACACGAATGAACTTCATCACGCAAGATCTGCCT
GGGTGGGCTCCCGATCAAGATTTAGCTCCGTACTCGAGGCTTTACAAGTCTGGAGACTTGGCCTACTATAATCCA
GATGGCACGCTCGAATTTGTGGCCCGCAAGGATACCCAAGTCAAAGTCTCGGGCTTCCGCGTGGAGCTGGTGGAA
ATTGAGCACTATATACGTCAAGGACTTGGCGGCGTTGAGCAAATCATTGTCGACGTGGTTGAATCTAGGGCTTCA
TCCAAGCCCAGACTGGCTGCCTTTGTGTGCTTCTCTTTAGCAACGTCAGCACCAAGTCATGACTTGGACGAAAGT
GACTTGCTGCTTCCGCTCGATGCGGCACTTACTCGACAGCTGTCTGAGCTCAAGGGCTATTTGCAAGCTAGGGTA
CCAGCTTATATGGTGCCAAGCATCTATATACCCGTTAGGCCCAATCTACCAGATCATATGCTTACACAATACATG
TTGGCTGATATGCAGAAAGAATCGCCAACGACGTATCAAGAAGCAATGATGCAAGGGCTTTGGGCAGATGTGTTG
CACATATCTCCTGATTTGATTGGTCGCAGTGACAGCTTCCTACTTTTAGGAGGCGACTCGCTGGCTGCGATACGT
CTAGTAGCCAGAGCTCGAGAGAAAGGAATTCGCGTCTCCGTGGCATCCATCTTTAGTGATCCACGTCTAAGCCAA
GTAGCTGGTGCTGCGTCCTTCGAGCAGTTTGAACACACCATGGTCGAGCCTTGGAGTCTCATCTCAACAAACGAA
CGTGCCTCGCTTATTGAAGTTGCCCGCAAGCAATGTTCGCTGGCCCCTAACGATGTTATTTATGACATTTATCCC
ACAAGTGCTTTACAAGAAGGTTTAATGGCATTGGCGACCAAGCAGTCAGGTTCTTACATGGCTCGATTCACTTTT
GACCTGGACGATATGATAGACTTGAATCGCTTCAAAGAGGCGTGGCAATATACGCTCGAGGCCTGCGACGCTTTA
CGTACGCATATCATCTTGCATGGCGCCACGACACTGCAGGCCGTTGTTCACCAAGAGCAAGCAATTCAGTGGAAG
CAGGATGGGCTGGGAGCCTTGAAGATGGAATACGGAACACCTCTGTGCGAGTATGCACTCAATCAACATTCCAGT
CCTAAACGCTTCGAACTCGCCCTTCATCACGCTATTTTCGATGGATGGAGCTTCGGCCTGATTATGCGTACTCTT
TCCGAGTCGTATCATGGAGCAAAAATAACTCCCTTGTTCCCCTATGCCAGCTTTGTCAAGTATGCCAAATCCATC
GATATTAAATCTGCTAGTGACTACTGGCGGGAACAGTTAAACGGCGCGACACGACCCGTCTTTCCCAGGAGTTCA
ACAACATCGGGTGAATCCTCCAGTCAAAGCTTTGCTCGAGAGATTCCCGTTCCCCAGGGCAAACCAGGCGTTACC
GTTGCCACCGTGCTTCGCGCTGCTTGGGCCATAGTACTTGCTCGATATAACGACGATGTATCCGACATCACTTTT
GGCGCGGCCGTTTCAGGCCGTCAGGCGCCTGTGGAGCATATTGAAGACATTGTTGGACCCGTTATATCAACAGTA
CCGATACGTGTCAAATTACTAAAGGAATGTCGGGCCAGCGACTTTTTGCAAGGCCTACAGCGCCAGGCTGCGGAA
ATGATGGCATTTGAACAGATGGGCCTGCAAAATATCAATAAATTGGGGACAGATGCGAAAAACGCGTGCGACTTT
TCGACTTTGCTCGTCATTCAGCCCCGTGCCATTTTCAGAGAGCTGTCGCATTCCTTCATGTCCATGACACAGGAA
GATGGCCAGGGCGCAAGTTTGTCCGAGTATTTCAGCTATCCTCTGGTTTGGCAGTGCCATGTCTCGGAACAAGGA
AAAATTCACTTGTACGCAATTTTCGACACGAATGTGCTCAGTGAGGCCCAAATCAACATCATGGCTGAGCAATAT
TGCCATGTTATCCACCAGCTATGGCTTGCCGACAACAGCCAAATTCTTCTCAAGGACGTCTCGCTCTGCAGTCCT
TACGACATGAATCTTGCCCTGACGTGGAGCGCCCCTTCGGAAACGCTGCCAGTTCGAGAAACTTTCCATTCTCTT
GTTGAGCGGCAGGCAAAGGCTCAACCTAATGCTCCGGCGATATACGCGTGGGACGGTGAATTGTCGTATGGCGAG
CTCTACGCCGCGGCAGACCGGTTGTCTAGGCTTTTGACACACAAACTGGGGGTTAAACTAGAAGAGCGGGTTATT
GTGTGCCTCGAAAAGTCACTCTGGTTTTATGTTGCGATACTAGCCGTCAACATGGCTGGCGGTGTTTGGGTTCCG
TTTGATCCCTCTCATCCACGGGACCGTCACAACAAAATTGCAAGCCAAGCGGGGGCTCGAATTGCGCTCACCTGG
CCAGACAACGAACAGAAACTGCAGGGACTCGTTGAACACATTATTCAACTATCTGCCGACTTGGACCAAGAGCTT
TTACTTGACGCTAACAAGTATCCTCCAGTCTATGTTCAAGTGGAGCCAAGCAACGCGGCGTATATTCTTTTTACA
TCAGGCACCACGGGAACGCCCAAGGGCATTGTTATGGAGCATGGAGCTCTATGCACTAGTCAGATTGCTATTGGA
AAAAAGCTCGGCATGGGCACGGATGTACGGCTACTGCAATTTGCAGCATACGTGTTCGATCTTAGTATCGGCGAG
ATGATCGGCCCCCTTGTCGCAGGTGGCTGCCTATGCGTTCCTTCAGAGCACGATCGAATGAATAACCTAGGTGGC
TTCATAAGTCAAGCTCGCGTCAATTGGGCGTACCTCACGCCATCCTTTGCAAGACTTATCGAGCCGACAAGTGTG
CCCGGGCTTGAATTGCTACTATTGGCAGGAGAGCCTGTAGGCAAGGACCATTTGAAATCGTGGATTGGCCGCGTG
CGGCTTATCAATGGTTGGGGTCCCTCGGAAACATGTTGTTTCAGCTCGCTTCAGGAATGGGATTCTATTGATCAA
TCACCGTTAACTATCGGGCGCTCTGTCGGGGCACGCTGTTGGATAGTTGAGTCGGACAACTTGGAAAGGCTCGCG
CCGATTGGGTGTATAGGAGAGATTGTTATTCAAGGCCCGACTATTGCTCGGGAGTATCTTGCCAATGATGAAGGC
ACCCGAGCCAGCTTCGTGGAACGACTTCCCTCGTGGGCCCCAGATGCGCCAGGACATCGTCGGTTATACAGGTCA
GGAGACCTGGGGTATTACAATGCGGATGGAACCATGGAATTTGTGTCGCGCAAGGACACGCAGGTCAAGGTGCGG
GGATTCCGTGTTGAGTTGGGTGAGGTGGAGCATCACATACGGCAAAGCCTCCGCGAGGCGCACCAAGTTGTCGTG
GACGTTCATCAGGACTCGACAAAGCTCGTCGCATACGTCTGCTTTTCTTCGGAAACGTCGAATAGTTCAAACAGC
TCGGACATGATTCGTCCCATGGACTCGAGCCTCGCTGCCAAGTTTTCGGAACTCAAGAGCTATCTAGGCGTCCGG
TTGCCAGAGTACATGATTCCTGCCGTTTATGTGCCGCTCAAGTTTGTTCCTTTTATTACGTCACAAAAGATTGAT
CGCGCAGTCCTACGCGATGCGACGTCTCCCGCCAACATGAAAGGCGATGACTTGGCCCGGTACATGCTTGCCGAC
ACAAGTAAAGAAACTCCTGCAAGTGAGCGAGAGATTACAATGCAGAAGCTATGGGCAGACGTCCTGCGAGTCTCT
ATTGAACTCATTGGACGTCACGATAGCTTCCTCCAGCTTGGTGGTGACTCTCTTGCCGCCATACGCCTAGTCACG
CAAGCTCGTAAACAAGGGATTCAGTTAACGGTGGCACAAATATTCCGCGATCCACGTCTCAGCCAGGTCGCGGCA
GTGGCACAATTTGGGGAAAGTATAGAGGAGACCTCCTCTGTGCAGCCCTGGAGCCTGATTTCCTCTAGCAGACGA
GGCACAATGAGGACAGTAATCCAAAGACAGTGTAACCTGAGGAGCGCAGACGAAATCTTGGACGTGTATCCAGCT
ACAGCTCTCCAGGAGGGACTCATGGCTTTGACGGCTCGACAACCTGGTGCGTACGTGACGAGATACATTTTCCAG
ATAGGCCACGACGTCAACGTGGACCGCTTCAAGACTGCATGGGAACAAACAGTGCAAAGCATAGATGCTCTTCGA
ACACGCATTGTTTTCCATGGCGGCAAGACATGGCAGGCAAAACTGGACCAGGGCGCTGAGTGGCTGCCGACGCAG
AGGTTTTCGAAATACAAGACGCCGATAGAAGCATTGGCCATGGGCTATGGAACCCGGCTATGTCTTTATGCACTC
GTTGATGGCGATTCAGGCGACAAGTACTTTGCCCTGACTATGCATCATTCCATTTACGATGGATGGTGCCTTCAG
CTCATCGCGCAGACGATAAAGCACTTTTATGACGCGAACCCTAGTCCTATCGGTTTGGCTCCCTATGCCAATTTC
ATCGACTTTACCCTGCGTCTAGATCTTAAGGCGGCCGCTGCATTTTGGAAGAAGCAGCTGGGCGGAGCGAAACGC
ACTATTTATCCGCAAATGGTCAAGAAGCCCAAGTTAAATTCTGAAACGTCTGGCAAGACACTCTGCTACGAAATC
ACGCTGCGCAAGTCTGCTGGAACCGTCACCATGGCAACAGTATTGAGAGCAGCATGGGCAATCGTTCTTGGACGC
TACAACGATGATGCCGACGATGTCACATTTGCCTCTACTGTGACGGGCCGGCAGACGCCAGTATCAGGTGTGGAC
CGCATGGTTGGACCAGTCATCTCAACGGTGCCCGTGCGAGTCAAATTGGACAAGACACAGAGCGTTGGCCAGTTT
CTCCACAGTGTGCATCTCGACGCAGCAGAAATGATTCCTTTTGAGCAGATGGGCTTACAAAACATTGCAAAGCTT
GGAGTCGAGATGCGAGAGGCATGCAACGTGTCGACATTGCTCGTGGTGCAGCCCGAAGAGCTCTTTGAACAATCG
ACCAATGGACTCCTCTCGTCTCAACCAACAGAAGCCGATGCCCTATTCAAAGGCTACTTCAACTACCCGCTCGTG
GCTCTAATATATCTCCGTTCTGATTGTGCCTTTTTGAACCTCATATACGACGCGTCGGCCATTTCAACGGCGCAG
GTGAATCGCATGGCCAAACAATATGAACATGTGGTGGAACAGCTGCTGGCTTATGGCGATGATTCAAGCCGCACC
GTCGACGATATCAACCTCTGCAGCACGGCGGACATGGACCAAGTCCTGCAGTGGCACGATGCTCTTGAACCAATG
GATATCACAAACGCCTGCGCACACCAGTTAATTTCCCAAACTGCAGCGCAGACTCCTGATCAAGAGGCCATCTTT
GCATGGGACGGAACATGTACGTACGGCGAGCTAGACCGTATGGCTACTCATCTGGCCAGTTTCTTGGCTTGCCAA
GGTGTTGGTCCTGAATCTCTTGTTCCCGTGTGCTTCGAAAAGTCCATGTGGATCGTCGTTGCCATATTGGCCATT
CAAAAGGCGGGTGGCGCGTATGTGCCGCTCAGTCCAGAGCATCCTCTCCTGCGACGCCAACAACTGGTGGCCAAA
ATCAAGGCTCCTCTGCTGCTTACATCTATAGCGGCAGAGAGTGCTTGTCAGGGCATCCAAGTCCCGATTGTAGTT
GTGTCTCGCGACACAATTGCAGGCTTGTCGGACAAAACGCAGCATGGTGCAGCTGAGAGTGTTTGCAACCCCAAC
AACGCAGCATATGTTCTCTTCACCTCTGGAACGACGGGAGAGCCCAAGGGCGTGGTGGCTGAGCACAAGGCGCTC
GTATCCGGACTTTTCCACTTTGCCCGAAAAACTGGTCTTTCGTCAGCTACACGAATGCTTCAGTTTTCAAACTAC
ATCTTTGATGTTAGTGTGAGCGAAATCTTTGGTACGCTGCTCCATGGCGGATGTATCTGTATCCCGTCAGAGGCG
GAGCGCATGGACAATATCGAAACATTTGTCAACCGGTCGCGCGCCAACTTTGCCATGGTGACTCCCTCTTTTGCT
GGTACACTATCACCAGCCAAGATGCCAACGCTAGAAGCCATGATCTTAGGTGGTGAAGCGCTTACCATGGACAAC
ATACAGACCTGGGCCAGCAAAGTGCGCTTGTTTAATAACTATGGCCCAGCCGAAGCCGGCGTCTCGACGAGCCAG
CATTTGGTAGAGCCAGGAAGCAGCGAGCCCAGCATTGTGGGTAGCGGCTGCAACAACCGTCTCTGGATCATTGAG
CCCAGCAACTCAGACCGCCTAACGCCTATTGGCTGCGTCGGCGAACTCGCCGTTCAAGGGCCATGCGTCTCTCGT
GGCTATCTCGAAGACGAGACGCGGACCAAGGCTTCTTTCCTCGAGTCGCCTTGCTGGCTGCCGAGCGGTGCGGCG
CATCGGCGCGTGTACAAGACGGGAGACTTGGTGCGGTATAGTGATGATGGCAGCGTGGTCTTTGTTGGGCGCAAG
GACGGGCAAATTAAGCTTCGTGGGCAGCGGCTGGAGCCGGGCGAGATTGAGTATTGGATCAAGAAGAGTTTGGGA
CAGAGGCACACCGTTTCTGTGCAGCTTATGCATGGGGTTGATGCGGGTGCATCGTTGGTGGCTTTTGTGTGTGCG
CCCCCGGAAGAGTGA
Gene >OphauB2|2027
ATGGTGCCGTCTTACTATTTGCCCGTTGCGCATCTTCCACTCAGTCTTTCTGGCAAAGTCGACGCCCAAAAGCTA
CGCGAATGGGCCGAACAATTATCAGCCCACAACCTTGTAGAGTATTCCGTCGCTGAACGAACAGAATATGAGCCT
CCGACAACAGACATAGAAAAGAAGCTTCAGCATCTCTGGGCATCAGCCTTGGAAATACCTATAGAGACAATTGGT
CGCAATGAAAGCTTTCTCGCACTGGGCGGCGACTCCATCGCGGCTATTCGCCTCGTGGCGGCTGCTCGAAGCCAA
GACATTACTCTTTCCGTCTCGTCCATCTTCAAACACCCCCAGCTGTCCCAGATGGCCTTGTCCGCCCGCCTCGAA
AAGGTGGTACAAGATGAGGCTTTGGAGGCATGGGGCATGATTGCGCAGGACGAGCGACAATCGATAGAGGACAGC
ATTCGAGAGCATTGTCAACTATCAGCACAAGATATCATTGAAGATGTCTATCCGGCGACACCGTTGCAAGAGGGT
CTCATGGCGTTGGCCGTGAAGCAGCCTGGTTCATACATGGCCACCTTTACATATCGACTTGCAGACGACGTCGAC
GCCGAATATTTCCAGAAAGCCTGGGAGACAACCCTGCAAGTCTGTAGCGTGCTTCGGACTCGAATTGTTGTTCAT
CGTGACCGAACTCTTCAAGCCATAGTTAAAACACCCCAAAAGGATTGGCTAAACGAGAAGAATAGTTGCTCGCGC
CACATGCAATACGGCACGCCACTATGCTACTCGTCTCTTGAGCGCGGCACTGACACCTCCTTGTTCCGTCTAACA
ATGCACCACGCAATATTTGATGGCTGGAGTTTTGGTCTCATTATGCGCACGCTGTCACAAGCCTACAGCGGCGCG
GCCAAACCCGATTTGTCTTTGCCTCATTATGGCAATTTTGTCAAGTATGCTCTTTCGCTCGACAAGTCTGACGCT
GCAGAATACTGGTCTAGCCAGCTCAAGGGCGCTACACGACCAATGTTTCCTGCGCGCCAGACGGCCAAATCGCCG
AAGCCGGCAAGCGCAACATTAACCTGCCACATACCGCTCGATACAGGGCGCCAGTTGCCCGTCACCAAGGCCACC
CTTCTCCGAGCTGCATGGGCTGTTTTAATGGCGCGATACAACGACACAGACGACATTTCTTTTGGAGCTGCAGTC
GCTGGGCGGCAAGCCCCCATCTCCGGTATCGAGGAAATAGTTGGCCCAGTCCTCTCGACCGTTCCGGTGCGAGTC
AAAGTTCCTGGCCAGCAGTCTATTAGTGACTTTTTGCAAACGCTACAGACACAAGCAACTGACATGATTCCATTC
GAGCACATGGGGCTGCAAAATATTGCCAAGCTGGGACTAGACGCGCGAGAAGCCTGTGACTTTTCTTCCATGTTT
TCGGTGCAGCATAACACAATTGCAAGCAAGGGAACGTCTTCATTGCTCATCTCAATTGTCAATACCTCCCCTGAT
ACCGCGCTCAACTTTGCTACTTACTTTACTTATCCGCTTGTCGGGCAATGCTTCCTCTCAGAGCATGAGGCCTCC
TTGGAGCTAATCTACAACTCCGCGTCACTCTCTTCTCAGCAGGTAGAGGGCCTGGCTGCTCAGTACTGTCATGTG
ATTGAGCAGCTGGTTACCCATATCACGGAAGCCAAGGAGACGCCACGGCTTAAAGACATTGAGATTTTCGGAGCG
TGGGACAAGACGCAGATTGAGCAATGGCATAGTCTTCAAGAGCCAGTCACCATGCTTGGCACCACCGTCTTGGAG
CTGCTCTCTACAGTTTCGACGAAATCACCAGATGACGAAGCCATTTGCGCATGGGACGGCAGCTGCACATATGCC
GAGCTAGAAAATATGACAACTGACTTGGCAAGTCACCTGCAAAGCCTTAAAGTCGGCAAGGGCTCGCTGGTTCCA
ATTTGCTTTGAAAAGTCCTTATGGACAGTAGTTGCTAAGATGGCCATCTTGAAGGCCGGCGCTGCCTTTGTCCCA
TTGAACCCCGATCATCCTTTGACCCGGCGAAAGCAGCTTGTGGACGTTCTCGAATCACCTCTGATTCTTGTTTCT
GAAGCTACGCAGCAATCTTGTCAAGACATGAACCTGCCACTTGTTACTATCTCAGAGGCCTGCGTGTCGAGACTA
CCCCAATGCACTTCGAAGCGAGATTATCCCAGCTCACAAGACACAGCATATGTTCTGTTTACCTCTGGCAGTACA
GGTGAGCCCAAGGGAGTTGTTGTGAGCCACGGTGCCCTAGCATCTTGCGTGCTCTCTCATGCACGGGATATTGGT
GTCCAGCCCGAGAGCCGAGTGCTACAATTCTCGGCCTATACTTTTGACATTAGTCTAGCAGAGACACTTTGCACT
CTTTGTTTTGGAGGCTGCTTGTGCATTCCGTCAACCGAGGAGCGTCTAAGCAGCTTGACAGCTTTTGTGCGAGAC
CGCCGGATAAACGTCACCATGCTCACGCCAACGATGCTATCAACAATATCTCCCCAAGAAATTCCTGGCGTTGAT
ACCGTCGTCCTCGTCGGTGAGCCAAGTACGCAGTCAACTTTGGATACTTGGTCAGACAAGGTGACTCTTATCAAC
AACTACGGGCCCAGTGAGGCTTCAATCAATACTAGCAGTCATCTGATTCTTCCGGGCCAAAAATCACCGCGAATG
ATTGGATCTGGATGCAACTCACGTCTTTGGATTGTCGAGCCTGATAATACCGAGTCTTTAGCTCCGGTTGGGTGT
GTTGGAGAGCTTGTGATTCAAGCAGCATCTATTGCCGATGGTTACCTAAACGACGTAAAACGGTCCAAAGAATCG
TTCATTCAAGCCCCTTCATGGCTTCCACAAGGGACTCTTCCAAAGCTATATAAGTCTGGAGATCTTGTGCGCTAT
CATAACGATGGAACACTGGAATATGTGGGGCGTAAAGATGGTCAGCTCAAGGTTCGTGGACAGAGACTTGAATCC
GGCGAAGTCGAATACCACATTAAACAGATACTTGGCCCACGATCAACCTCATCAGTTCAACTCATCCAAGGAGAA
AACGTTGGCGGCAAGGCCCTAGTGGCTTTTGTCTGTCTATCGGGTAGCACCCGCTGCATCGATGATGGCGAATGT
CACTCATTGTGGGCAAGAGACGACAACACATTCGATCTTCTCTTTAGCCTCCACCAGAGTCTCCGAAGTGTTTTG
CCTGACTATATGGTGCCTTCCTACTTTCTCCCAGTCGCATACCTCCCCGTAACATCTTCGGGCAAGACAGACGGG
CGAACAATTCGAACATGGGCTTCTACCATAGAGCGAGACGACATGGCGCAATTTTCCCTTTCTTCAAGTGTGCCA
TTTGTTCCGCCAACGACAGCCATGGAAAAGAAGCTTCAGGGGATGTGGGCAGACGTCCTTGGGATACCAGCGGAG
TCGATTGGCTGCGAGGATAACTTTCTTGATCGAGGAGGCGATTCCATTGCAGCTATTCACTTGGTCTCAATGGCA
CGGCAACACGGCATTGCTCTTACCGTATCTTCTATCTTCTCAGATGCACGCCTAAGCCACGTCGCAGCTTCCGCT
GTGCCGTTAAAAGATGAAAATGGTGATGGAAACGTGGATCCTTGGGCCTTGATTCCAAAAGAGGACCAGGCTCAG
GTTATCGAGTCGGTCCGCCAACAATGTCGTCTTTCGACAGAGCAAGCCATTGACGACGTATACCCGGCCACGGCG
CTGCAAGAAGGACTGATGGCATTGGCAGCGAAGCAACCTGGTTCTTACGTAGCTCGGTTCACCTTTGAGCTAGGA
CGCGCTGTCGATACGAGCCGTTTCAAAGAAGCCTTTTCGCATACCGTTGCCTCTTGCAGCACTCTGCGCACTCGA
CTTATTCTCTGGCGCGATCAGACAGTCCAGGCAGTCTTGAAGCACAGCGACGTGTGGCCACTGGAAGGCGTGCAG
AAATCTGAAGCCATGGGATATGGCACCCCGCTTTTTTTATATGCGCTTCGAGACAGAGGAAGCAGGCGAGAATTC
CATTTGGCCATGCACCACGCCATTTTTGACGGATGGAGCGTCGGGCTCATCATGCGAACCCTCTCACAGTTCTAC
CACCAGGGCCGCGTGCAAAGACCGCTGGTACCATACGTCAATTTTGTTAAGTATGCCCAATCTCTTGATGGAGAG
CAGGCCAACGAATTTTGGCGAAGCCAGCTCCAAGGAGCCTCAAAAACCACCTTCCCTAAGCGCACTGCCTCCAGC
GCATCTTGCAGCCAAACACTCATACGTCAAATTCATCTGCGCCATCACGTTGGCTCCAATTCCGCCATTACCACT
GCAACGGTTCTGCGTGCAGCTTGGGCCATTGTGCTTGCGAGATACAACGATAGCGCGCCAAATGTCACATTTGGT
GCAGCGGTTGCTGGAAGACAGGCCCCAGTGCCTGGCATTGACGATATAGTTGGGCCTGTTCTCTCTACCGTGCCT
ATGCGGGTTAATCTCGAGGGTACAGAGTTAGTGACCTCCTTCTTGCAGCGCATACAAGCTCAGTCTGTGGATATG
ATGCCGTTTGAACAGTTGGGCTTGCAAAATATTTCTCGTCTTGGGCCCGATGCTAAAAACGCCTGCGACTTTTCC
TCGCTGCTAATCATCCAACACCGAGGCATCTTCCACACTGGCGAAGAATCTCTGCTCGTTGTTCCTGAAGATTGG
TCCGCTTCAACGGGCGGTGGAGAGGCCACATATTTCAACTATCCCATTGTTGTGCAGTGCTTCCTTTTGGAGCAA
AAGGTGATGCTGGAGCTGATCTATGACGACGCGGCAGTGACATCAGATCAGGCGCAGGCAATTGCTTCCCACTAC
ATCAATGTCGTACAGCAATTGATAAAGGCACAAGAGCGCCGTGAGCAGGACCAATTAGTCCTCTCAGACATTTCC
CTATTCGGAGAATGGGACGCAGAGAAGATTCAGGAATGGCACCAGGGGCAGCCGCCTATGGAGACTGTCGACACA
TGTATGCATGACCTGATTTCCAAGACCACTCGGATGCTCCCAGACAAAGAGGCCGTGTTCGCCTGGGATGGAAAG
TGTTCTTATGCCGAGTTGGAGTGCATGACACATAGCCTGGCTCATTACCTGCGCGAACAAGGTGTTGGTCACGAA
TCCCTTGTTCCCATATGCTTTGAAAAGTCGATATGGGCCATTGTGGCCATGCTAGGCATTATGAGGGCAGGTGGT
GCATTTGTGCCACTAAACCCCAATGATCCGTTTGCACGCCGTCAACATCTGGTAGCCAGCCTTCAAGCACCCCTG
ATATTGGCCTCTTGTTCCACGAGTAGCCTCTTTGACGGTATTGGGGTCAATACTGTCGTCATTGCATCGGAATTG
ATCTCATCGCTCCCGACAGCTCAGGTTGAGAGCATTACGACACCGCATAGCGTTGCCTATGTGCTCTTCACATCT
GGAAGTACAGGCGAGCCCAAGGGCGTCATTGTCGAGCATCGATCACTGTGCTCGACTATCTCTCATCGCGGGGAT
GATATTGGTCTGACGGCAGATTGGCGGATTCTGCAATTCTCGAGCTATGTCTTTGATATCAGCGTGTGCGAGATA
TTTGCCTCGTTGGCCCATGGCGCGACGCTGTGTGTCCCGTCAGAGGCGGATAGAGTTAACAGCTTGGCAGGCTTC
ATTAACAAGGCAGAGGTCACGTGCGCCATGCTGACCTCCACTGTAGCCAAACTGCTCACGCCGGCCGACGTTCCC
TCTCTGACGACCTTGCTGCTTGTTGGAGAGGCTCCAACGGTGGAAAACGCCCGAACCTGGGCAGATGCCGTCAAG
CTCTTTAACGATTACGGTCCCGCTGAAGCCTGCATTTTTGTCACGTCGCGCCTCATCCTGCCATCTGCATCTACA
ACAAACATTGGAAGCGGCTGCAATGCGCGCCTGTGGGTCGTCGAGCCAGACGACCACAACCGGCTTGCGCCCGTG
GGTTGTACTGGCCATCTCGTGATCCAAGGCCCTGGTGTAGCCCGTGGCTATCTCAACGATGCTGGCAGAACAGCC
GAGGCTTTCCTCTCAACCACGCCATGGCAGTCGTCAGCCAGCGTGCACAAACTCTACAAGACTGGGGACTTGGTG
CGCTACACTAACGATGGCTCCCTCGAGTACATTGGACGCAAGGATGGCCAGATCAAGCTTCGTGGCCAGAGGCTC
GAGCCGGGAGAAATCGAATACCACATTAAACATCATCTCGGGCCGCAATCGACTTCTTCTGTGCAAATCATCCAT
GGACCAGCCATGGGAGAAGGCGCACTCTTTGCCTTTGTATGCCTTGTGGGCCAAACAGATATGTTGGCTGCCAGT
GAGGGTGACTTGATCTCCACATTCGACGAGGATACGCAGCATCTACTGCAAGACCTAGACGAGGCTCTTCGTGCT
TCCCTTCCGGCATACATGGTTCCATCGCATTATGTGCCTGTTAAGTGGCTACCCGTTACGCCCTCGGGCAAGATG
AACAGCCGCTCTCTGAGAGAGATAGCCCTTTGCTTGCCACCAAGTGATTTGGCTCAATATTCTCTCTCTACCAGA
GCCGAATTTGAGCCGCCTCAAACCCCAATGGAAGTGCACATGGTCGAGCTCTGGGCCGACATCCTCGGCTGTTTG
TCTCAAAACATTGGCCGCAGCGATAATTTCCTTCAAATTGGCGGCGATTCCATCATGGCGATACGACTGGTAGCA
GCTGCCCGCAAGCAAAACATTAACCTGGCCGTTTCAACCATTTTCCGAGATGCGCGCTTGAGTCAAGTGGCTGCT
GCTGCAGAGTTGTCTAGCAATGGGCCAGTTGAGCATGCTGACGTAGAACCATGGAGTCTGCTTCCACAAAATGAC
TCTTCGGCCATCGCAAAATCTGTGCGCCAACAGTGCTTCTTTCCGCCACATGCTGACAATGATGACGATGGCGAC
ATTATTCAAGACGTTTATCCCGCAACACCTTTGCAAGAGGGCTTGATGGCGCTGGCAGTCAAGCAGCCAGGCTCG
TATATGGCTCGTTTCTCATTTAAGCTAGCCGATGATGTCGATATCCATCGTTTCCGAGAAGCCTGGCAAGCTACC
CTCACTGCCTGTGATGTGCTTCGCACGAGACTGGTCTTATTCGGAGAACACACTCTCCAAGCGGTGCTTTGTCCA
CGCGGTCAATGGCAGAATTTGAACACGAAGAATGTTACAATGAGCTATGGCACTCCGCTCTGCAGCTATGCCCTG
GTGGACAATGACACTGGCTTGCACTTTGAGCTTGTGTTACACCACGCTATTTTCGATGGCTGGAGCTTGAAAATC
ATCCTCAGAACCTTACTGACGGCTTATTGCCAGAATGAGTCGCAAAAATCACCAAGACTGCCCCGATATGCCAAC
TTTATCCGCTACTCCCTTACCCTCAACACCAACGAGGCAGAAGAATTTTGGAAGCAACAGCTTAGAGGAGCTGCT
CGGCCAATTTTCCCTAAGCAGTTATTGGCGCAGAATGCAGCTAGCAGCCAGGCCATTACCCGCGAGATGCCTCTG
CGTGCTATTGGTCGCCTTAACATCACTACTGCCACTGTGCTTCGGACGGCATGGGCTATTGTCCTGGCCCGCTAC
AACGATGCAACGAACAACATCACTTTTGGTGCTGCAGTTGCAGGCCGTCAGGCCCCCGTGGCTGGTATCGAGGAC
ATTGTCGGTCCCATTATTTCAACTGTCCCTGTCCGAATCAGCCTCGACCCGGAGCAATCTGTGCATCATTTGCTA
CAAAGAATTCAAGCACAGGCCACAGATATGATGGCTTTTGAGCAATTTGGTCTGCAAAAGATCGCCAAGCTAAGC
CCTGATGCACGGAATGCGTGTGCTTTCTCATCATTGCTTGTTGTGCAACCAGATGCAGTCTTTGGGAAGACATCA
AACTCGGTCATGGTCTTGGAGCCTGGCAATGACAACAAAAACGCTGCTTCTCCCCTTGCCGAATACTTTAGTTAC
CCGCTGGTTTGGCAATGCCATGTGACAGATTCCGCTATACACTTGCATGCCATTTTCGACTCTTCGGTATTAAGC
AAGCAGCAAATAAACGCCATGGCCGAACAGTTCTGTCATGTTGTACAGCAACTATGCAACGCTGAAGCAGAGCCT
GCTAACAAAACTCGAACAAGGGATATCTCTCTTAGTGGTCCCTTCGATCTGGCTCTTGCTCAAGAATGGAATGAC
GCCGTGGATACCAAGGTCATTTCCGACACCCTGCATGCCCAATTTGAGAAGCAAGCAAAACGACGTCCGGGCGCG
CCTGCCATCTTTGCATGGGATGGCTGCCTATCATATAGAGAGTTGGATACAGCTGCTGATCACCTGGCACAACTG
CTTAGACAACAATACGGTGTTGGGCCAGACGACCTTGTACTGGTCTGTTTTGAGAAATCCATCTGGTTCTACGTC
GCTATTCTTGCCATCAATAAAGCTGGCGGTGCTTGGGTTCCCATCGACCCTAGTCATCCAGCACACAGGCACAAA
AAGATAGCTGACCAAGCTAGCGCCTCTCTTGCCCTGGCGTCCGCCACGGCAGCCGCGTCATGTATAGGACTTGTC
AAGAATGTAGTGCAGGTTTCATCAGCACTTCACGAGGAGCTTTTATTGAAGCCTCTCGAAATGCCTGCGGTCGAG
GTTTTGCCCCATCACGCGGCATATGTCTTGTTCACATCTGGCACTACGGGGACTCCCAAGGGTATTATCATGGAA
CACGGCTCGCTTTGCACGAGTCAAACAGCTATTAGCCGCCGGCTTAATCTCGATGAAAACGTGAGGATGCTTCAG
TTCGCGGCCTACGTGTTCGATCTGAGCATAGGCGAAATGATTGCTCCCTTGATCTCCGGAGCTTGTCTGTGTGTG
CCCGCAGAACATCATCGCAAAAGCTTGACCGATTTGTCAGTGTTTATGCGCGAGGCAAGAGTCAACTGGGCATAT
TTGACTCCTTCATTTGCCAGGCTTATCGATCCAGACACTATGCCTGGATTAGAGCTTCTTCTTCTGGCTGGCGAA
GCTGTTGGCAAAGACTTGCTCGAGACATGGGCTAGTCGTGTTCGACTAGTCAATGGCTGGGGGCCATCCGAGACT
TGCTGCTTCAGTTCATTAAATGAATGGGATAGTGCTTCGCAATCTCCCCTCAATATCGGATACCCCGTCGGCGGT
CGATGCTGGATTACAGAACCCGACAATCACCATCAACTGGCTCCTATTGGATGTGTGGGCGAGGTTTTGATCCAA
GGGCCCACAATTGCCCGAGAATACCTCGATTATGCTCAAGGAACACGAATGAACTTCATCACGCAAGATCTGCCT
GGGTGGGCTCCCGATCAAGATTTAGCTCCGTACTCGAGGCTTTACAAGTCTGGAGACTTGGCCTACTATAATCCA
GATGGCACGCTCGAATTTGTGGCCCGCAAGGATACCCAAGTCAAAGTCTCGGGCTTCCGCGTGGAGCTGGTGGAA
ATTGAGCACTATATACGTCAAGGACTTGGCGGCGTTGAGCAAATCATTGTCGACGTGGTTGAATCTAGGGCTTCA
TCCAAGCCCAGACTGGCTGCCTTTGTGTGCTTCTCTTTAGCAACGTCAGCACCAAGTCATGACTTGGACGAAAGT
GACTTGCTGCTTCCGCTCGATGCGGCACTTACTCGACAGCTGTCTGAGCTCAAGGGCTATTTGCAAGCTAGGGTA
CCAGCTTATATGGTGCCAAGCATCTATATACCCGTTAGGCGTATGCCGTTTATTACGTCTCACAAGATAGACCGT
GGCACTTTACGGAGCACTGCAGCCAATCTACCAGATCATATGCTTACACAATACATGTTGGCTGATATGCAGAAA
GAATCGCCAACGACGTATCAAGAAGCAATGATGCAAGGGCTTTGGGCAGATGTGTTGCACATATCTCCTGATTTG
ATTGGTCGCAGTGACAGCTTCCTACTTTTAGGAGGCGACTCGCTGGCTGCGATACGTCTAGTAGCCAGAGCTCGA
GAGAAAGGAATTCGCGTCTCCGTGGCATCCATCTTTAGTGATCCACGTCTAAGCCAAGTAGCTGGTGCTGCGTCC
TTCGAGCAGTTTGAACACACCATGGTCGAGCCTTGGAGTCTCATCTCAACAAACGAACGTGCCTCGCTTATTGAA
GTTGCCCGCAAGCAATGTTCGCTGGCCCCTAACGATGTTATTTATGACATTTATCCCACAAGTGCTTTACAAGAA
GGTTTAATGGCATTGGCGACCAAGCAGTCAGGTTCTTACATGGCTCGATTCACTTTTGACCTGGACGATATGATA
GACTTGAATCGCTTCAAAGAGGCGTGGCAATATACGCTCGAGGCCTGCGACGCTTTACGTACGCATATCATCTTG
CATGGCGCCACGACACTGCAGGCCGTTGTTCACCAAGAGCAAGCAATTCAGTGGAAGCAGGATGGGCTGGGAGCC
TTGAAGATGGAATACGGAACACCTCTGTGCGAGTATGCACTCAATCAACATTCCAGTCCTAAACGCTTCGAACTC
GCCCTTCATCACGCTATTTTCGATGGATGGAGCTTCGGCCTGATTATGCGTACTCTTTCCGAGTCGTATCATGGA
GCAAAAATAACTCCCTTGTTCCCCTATGCCAGCTTTGTCAAGTATGCCAAATCCATCGATATTAAATCTGCTAGT
GACTACTGGCGGGAACAGTTAAACGGCGCGACACGACCCGTCTTTCCCAGGAGTTCAACAACATCGGGTGAATCC
TCCAGTCAAAGCTTTGCTCGAGAGATTCCCGTTCCCCAGGGCAAACCAGGCGTTACCGTTGCCACCGTGCTTCGC
GCTGCTTGGGCCATAGTACTTGCTCGATATAACGACGATGTATCCGACATCACTTTTGGCGCGGCCGTTTCAGGC
CGTCAGGCGCCTGTGGAGCATATTGAAGACATTGTTGGACCCGTTATATCAACAGTACCGATACGTGTCAAATTA
CTAAAGGAATGTCGGGCCAGCGACTTTTTGCAAGGCCTACAGCGCCAGGCTGCGGAAATGATGGCATTTGAACAG
ATGGGCCTGCAAAATATCAATAAATTGGGGACAGATGCGAAAAACGCGTGCGACTTTTCGACTTTGCTCGTCATT
CAGCCCCGTGCCATTTTCAGAGAGCTGTCGCATTCCTTCATGTCCATGACACAGGAAGATGGCCAGGGCGCAAGT
TTGTCCGAGTATTTCAGCTATCCTCTGGTTTGGCAGTGCCATGTCTCGGAACAAGGAAAAATTCACTTGTACGCA
ATTTTCGACACGAATGTGCTCAGTGAGGCCCAAATCAACATCATGGCTGAGCAATATTGCCATGTTATCCACCAG
CTATGGCTTGCCGACAACAGCCAAATTCTTCTCAAGGACGTCTCGCTCTGCAGTCCTTACGACATGAATCTTGCC
CTGACGTGGAGCGCCCCTTCGGAAACGCTGCCAGTTCGAGAAACTTTCCATTCTCTTGTTGAGCGGCAGGCAAAG
GCTCAACCTAATGCTCCGGCGATATACGCGTGGGACGGTGAATTGTCGTATGGCGAGCTCTACGCCGCGGCAGAC
CGGTTGTCTAGGCTTTTGACACACAAACTGGGGGTTAAACTAGAAGAGCGGGTTATTGTGTGCCTCGAAAAGTCA
CTCTGGTTTTATGTTGCGATACTAGCCGTCAACATGGCTGGCGGTGTTTGGGTTCCGTTTGATCCCTCTCATCCA
CGGGACCGTCACAACAAAATTGCAAGCCAAGCGGGGGCTCGAATTGCGCTCACCTGGCCAGACAACGAACAGAAA
CTGCAGGGACTCGTTGAACACATTATTCAACTATCTGCCGACTTGGACCAAGAGCTTTTACTTGACGCTAACAAG
TATCCTCCAGTCTATGTTCAAGTGGAGCCAAGCAACGCGGCGTATATTCTTTTTACATCAGGCACCACGGGAACG
CCCAAGGGCATTGTTATGGAGCATGGAGCTCTATGCACTAGTCAGATTGCTATTGGAAAAAAGCTCGGCATGGGC
ACGGATGTACGGCTACTGCAATTTGCAGCATACGTGTTCGATCTTAGTATCGGCGAGATGATCGGCCCCCTTGTC
GCAGGTGGCTGCCTATGCGTTCCTTCAGAGCACGATCGAATGAATAACCTAGGTGGCTTCATAAGTCAAGCTCGC
GTCAATTGGGCGTACCTCACGCCATCCTTTGCAAGACTTATCGAGCCGACAAGTGTGCCCGGGCTTGAATTGCTA
CTATTGGCAGGAGAGCCTGTAGGCAAGGACCATTTGAAATCGTGGATTGGCCGCGTGCGGCTTATCAATGGTTGG
GGTCCCTCGGAAACATGTTGTTTCAGCTCGCTTCAGGAATGGGATTCTATTGATCAATCACCGTTAACTATCGGG
CGCTCTGTCGGGGCACGCTGTTGGATAGTTGAGTCGGACAACTTGGAAAGGCTCGCGCCGATTGGGTGTATAGGA
GAGATTGTTATTCAAGGCCCGACTATTGCTCGGGAGTATCTTGCCAATGATGAAGGCACCCGAGCCAGCTTCGTG
GAACGACTTCCCTCGTGGGCCCCAGATGCGCCAGGACATCGTCGGTTATACAGGTCAGGAGACCTGGGGTATTAC
AATGCGGATGGAACCATGGAATTTGTGTCGCGCAAGGACACGCAGGTCAAGGTGCGGGGATTCCGTGTTGAGTTG
GGTGAGGTGGAGCATCACATACGGCAAAGCCTCCGCGAGGCGCACCAAGTTGTCGTGGACGTTCATCAGGACTCG
ACAAAGCTCGTCGCATACGTCTGCTTTTCTTCGGAAACGTCGAATAGTTCAAACAGCTCGGACATGATTCGTCCC
ATGGACTCGAGCCTCGCTGCCAAGTTTTCGGAACTCAAGAGCTATCTAGGCGTCCGGTTGCCAGAGTACATGATT
CCTGCCGTTTATGTGCCGCTCAAGTTTGTTCCTTTTATTACGTCACAAAAGATTGATCGCGCAGTCCTACGCGAT
GCGACGTCTCCCGCCAACATGAAAGGCGATGACTTGGCCCGGTACATGCTTGCCGACACAAGTAAAGAAACTCCT
GCAAGTGAGCGAGAGATTACAATGCAGAAGCTATGGGCAGACGTCCTGCGAGTCTCTATTGAACTCATTGGACGT
CACGATAGCTTCCTCCAGCTTGGTGGTGACTCTCTTGCCGCCATACGCCTAGTCACGCAAGCTCGTAAACAAGGG
ATTCAGTTAACGGTGGCACAAATATTCCGCGATCCACGTCTCAGCCAGGTCGCGGCAGTGGCACAATTTGGGGAA
AGTATAGAGGAGACCTCCTCTGTGCAGCCCTGGAGCCTGATTTCCTCTAGCAGACGAGGCACAATGAGGACAGTA
ATCCAAAGACAGTGTAACCTGAGGAGCGCAGACGAAATCTTGGACGTGTATCCAGCTACAGCTCTCCAGGAGGGA
CTCATGGCTTTGACGGCTCGACAACCTGGTGCGTACGTGACGAGATACATTTTCCAGATAGGCCACGACGTCAAC
GTGGACCGCTTCAAGACTGCATGGGAACAAACAGTGCAAAGCATAGATGCTCTTCGAACACGCATTGTTTTCCAT
GGCGGCAAGACATGGCAGGCAAAACTGGACCAGGGCGCTGAGTGGCTGCCGACGCAGAGGTTTTCGAAATACAAG
ACGCCGATAGAAGCATTGGCCATGGGCTATGGAACCCGGCTATGTCTTTATGCACTCGTTGATGGCGATTCAGGC
GACAAGTACTTTGCCCTGACTATGCATCATTCCATTTACGATGGATGGTGCCTTCAGCTCATCGCGCAGACGATA
AAGCACTTTTATGACGCGAACCCTAGTCCTATCGGTTTGGCTCCCTATGCCAATTTCATCGACTTTACCCTGCGT
CTAGATCTTAAGGCGGCCGCTGCATTTTGGAAGAAGCAGCTGGGCGGAGCGAAACGCACTATTTATCCGCAAATG
GTCAAGAAGCCCAAGTTAAATTCTGAAACGTCTGGCAAGACACTCTGCTACGAAATCACGCTGCGCAAGTCTGCT
GGAACCGTCACCATGGCAACAGTATTGAGAGCAGCATGGGCAATCGTTCTTGGACGCTACAACGATGATGCCGAC
GATGTCACATTTGCCTCTACTGTGACGGGCCGGCAGACGCCAGTATCAGGTGTGGACCGCATGGTTGGACCAGTC
ATCTCAACGGTGCCCGTGCGAGTCAAATTGGACAAGACACAGAGCGTTGGCCAGTTTCTCCACAGTGTGCATCTC
GACGCAGCAGAAATGATTCCTTTTGAGCAGATGGGCTTACAAAACATTGCAAAGCTTGGAGTCGAGATGCGAGAG
GCATGCAACGTGTCGACATTGCTCGTGGTGCAGCCCGAAGAGCTCTTTGAACAATCGACCAATGGACTCCTCTCG
TCTCAACCAACAGAAGCCGATGCCCTATTCAAAGGCTACTTCAACTACCCGCTCGTGGCTCTAATATATCTCCGT
TCTGATTGTGCCTTTTTGAACCTCATATACGACGCGTCGGCCATTTCAACGGCGCAGGTGAATCGCATGGCCAAA
CAATATGAACATGTGGTGGAACAGCTGCTGGCTTATGGCGATGATTCAAGCCGCACCGTCGACGATATCAACCTC
TGCAGCACGGCGGACATGGACCAAGTCCTGCAGTGGCACGATGCTCTTGAACCAATGGATATCACAAACGCCTGC
GCACACCAGTTAATTTCCCAAACTGCAGCGCAGACTCCTGATCAAGAGGCCATCTTTGCATGGGACGGAACATGT
ACGTACGGCGAGCTAGACCGTATGGCTACTCATCTGGCCAGTTTCTTGGCTTGCCAAGGTGTTGGTCCTGAATCT
CTTGTTCCCGTGTGCTTCGAAAAGTCCATGTGGATCGTCGTTGCCATATTGGCCATTCAAAAGGCGGGTGGCGCG
TATGTGCCGCTCAGTCCAGAGCATCCTCTCCTGCGACGCCAACAACTGGTGGCCAAAATCAAGGCTCCTCTGCTG
CTTACATCTATAGCGGCAGAGAGTGCTTGTCAGGGCATCCAAGTCCCGATTGTAGTTGTGTCTCGCGACACAATT
GCAGGCTTGTCGGACAAAACGCAGCATGGTGCAGCTGAGAGTGTTTGCAACCCCAACAACGCAGCATATGTTCTC
TTCACCTCTGGAACGACGGGAGAGCCCAAGGGCGTGGTGGCTGAGCACAAGGCGCTCGTATCCGGACTTTTCCAC
TTTGCCCGAAAAACTGGTCTTTCGTCAGCTACACGAATGCTTCAGTTTTCAAACTACATCTTTGATGTTAGTGTG
AGCGAAATCTTTGGTACGCTGCTCCATGGCGGATGTATCTGTATCCCGTCAGAGGCGGAGCGCATGGACAATATC
GAAACATTTGTCAACCGGTCGCGCGCCAACTTTGCCATGGTGACTCCCTCTTTTGCTGGTACACTATCACCAGCC
AAGATGCCAACGCTAGAAGCCATGATCTTAGGTGGTGAAGCGCTTACCATGGACAACATACAGACCTGGGCCAGC
AAAGTGCGCTTGTTTAATAACTATGGCCCAGCCGAAGCCGGCGTCTCGACGAGCCAGCATTTGGTAGAGCCAGGA
AGCAGCGAGCCCAGCATTGTGGGTAGCGGCTGCAACAACCGTCTCTGGATCATTGAGCCCAGCAACTCAGACCGC
CTAACGCCTATTGGCTGCGTCGGCGAACTCGCCGTTCAAGGGCCATGCGTCTCTCGTGGCTATCTCGAAGACGAG
ACGCGGACCAAGGCTTCTTTCCTCGAGTCGCCTTGCTGGCTGCCGAGCGGTGCGGCGCATCGGCGCGTGTACAAG
ACGGGAGACTTGGTGCGGTATAGTGATGATGGCAGCGTGGTCTTTGTTGGGCGCAAGGACGGGCAAATTAAGCTT
CGTGGGCAGCGGCTGGAGCCGGGCGAGATTGAGTATTGGATCAAGAAGAGTTTGGGACAGAGGCACACCGTTTCT
GTGCAGCTTATGCATGGGGTTGATGCGGGTGCATCGTTGGTGGCTTTTGTGTGTGCGCCCCCGGAAGAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail