Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2025
Gene name
LocationContig_16:137539..138508
Strand+
Gene length (bp)969
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.7E-06 50 301

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11120
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|2025 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2025
MAWTPPPRCYTSASTCSGPHDTNSCLGKTLKLSDGRILGYHTYGAPHGVPVLYLHGVVDTGVTLEGKEDALGKEM
GIRWIAPDRPGVGKSSFHHGRTILGYTDDIRQLVQHLDLKGYYILGVSGGSAYTLACAKVLPRQQVRGVGIGVGV
APWHAGRKGQTLKTLLQMYMMKYWPARLLKDTQDTYVPLARDADPAPMENRFRQNMLPYMDAVEADKWIKTDPIQ
SSVRVYRQYYAHGIDAHVDDMRLLTRPWGFRIEEVGYEGVKLWYGSADTNTPADMGLYLARRLPKSIYKEYAGET
HSSLLTSGHFRGILSDLISDAQ*
Coding >OphauB2|2025
ATGGCTTGGACGCCACCACCTCGTTGCTACACTTCTGCATCAACATGCTCTGGGCCCCACGATACCAACTCCTGC
TTGGGCAAGACGCTCAAGCTCAGCGACGGACGCATCCTCGGCTACCATACTTACGGCGCTCCTCACGGCGTCCCT
GTCCTCTATCTCCACGGCGTCGTTGATACGGGCGTCACCCTCGAGGGCAAGGAAGACGCACTGGGAAAGGAAATG
GGCATTCGCTGGATTGCGCCTGACCGTCCCGGCGTGGGAAAGAGTTCTTTCCATCACGGGAGGACGATTCTAGGA
TACACAGACGACATTCGCCAGCTGGTGCAACACTTGGATCTCAAGGGGTACTACATTCTCGGTGTCAGCGGCGGG
TCGGCATATACGCTTGCATGCGCAAAGGTTCTGCCTCGCCAACAAGTGCGCGGCGTAGGCATTGGCGTGGGCGTC
GCGCCCTGGCATGCGGGACGCAAAGGTCAGACCCTCAAGACGCTGCTGCAAATGTACATGATGAAATACTGGCCC
GCGCGTCTCTTAAAGGACACGCAAGACACTTATGTCCCCCTGGCGCGAGATGCCGATCCGGCGCCCATGGAGAAT
CGCTTCCGTCAAAACATGCTTCCTTATATGGATGCCGTTGAGGCTGATAAATGGATCAAGACGGATCCCATTCAG
AGCAGCGTGCGCGTCTACCGACAGTACTATGCCCATGGCATTGATGCCCACGTCGACGACATGCGTCTTCTTACA
CGGCCCTGGGGCTTCCGCATCGAGGAGGTTGGCTACGAAGGCGTCAAGCTCTGGTATGGCAGCGCAGACACCAAC
ACGCCCGCAGACATGGGCTTGTATCTTGCTCGCCGCCTGCCCAAGAGCATATATAAGGAGTACGCGGGCGAGACG
CATAGCTCATTGCTTACCAGTGGTCACTTTCGGGGTATTTTAAGCGATCTGATTTCGGATGCGCAATAA
Transcript >OphauB2|2025
ATGGCTTGGACGCCACCACCTCGTTGCTACACTTCTGCATCAACATGCTCTGGGCCCCACGATACCAACTCCTGC
TTGGGCAAGACGCTCAAGCTCAGCGACGGACGCATCCTCGGCTACCATACTTACGGCGCTCCTCACGGCGTCCCT
GTCCTCTATCTCCACGGCGTCGTTGATACGGGCGTCACCCTCGAGGGCAAGGAAGACGCACTGGGAAAGGAAATG
GGCATTCGCTGGATTGCGCCTGACCGTCCCGGCGTGGGAAAGAGTTCTTTCCATCACGGGAGGACGATTCTAGGA
TACACAGACGACATTCGCCAGCTGGTGCAACACTTGGATCTCAAGGGGTACTACATTCTCGGTGTCAGCGGCGGG
TCGGCATATACGCTTGCATGCGCAAAGGTTCTGCCTCGCCAACAAGTGCGCGGCGTAGGCATTGGCGTGGGCGTC
GCGCCCTGGCATGCGGGACGCAAAGGTCAGACCCTCAAGACGCTGCTGCAAATGTACATGATGAAATACTGGCCC
GCGCGTCTCTTAAAGGACACGCAAGACACTTATGTCCCCCTGGCGCGAGATGCCGATCCGGCGCCCATGGAGAAT
CGCTTCCGTCAAAACATGCTTCCTTATATGGATGCCGTTGAGGCTGATAAATGGATCAAGACGGATCCCATTCAG
AGCAGCGTGCGCGTCTACCGACAGTACTATGCCCATGGCATTGATGCCCACGTCGACGACATGCGTCTTCTTACA
CGGCCCTGGGGCTTCCGCATCGAGGAGGTTGGCTACGAAGGCGTCAAGCTCTGGTATGGCAGCGCAGACACCAAC
ACGCCCGCAGACATGGGCTTGTATCTTGCTCGCCGCCTGCCCAAGAGCATATATAAGGAGTACGCGGGCGAGACG
CATAGCTCATTGCTTACCAGTGGTCACTTTCGGGGTATTTTAAGCGATCTGATTTCGGATGCGCAATAA
Gene >OphauB2|2025
ATGGCTTGGACGCCACCACCTCGTTGCTACACTTCTGCATCAACATGCTCTGGGCCCCACGATACCAACTCCTGC
TTGGGCAAGACGCTCAAGCTCAGCGACGGACGCATCCTCGGCTACCATACTTACGGCGCTCCTCACGGCGTCCCT
GTCCTCTATCTCCACGGCGTCGTTGATACGGGCGTCACCCTCGAGGGCAAGGAAGACGCACTGGGAAAGGAAATG
GGCATTCGCTGGATTGCGCCTGACCGTCCCGGCGTGGGAAAGAGTTCTTTCCATCACGGGAGGACGATTCTAGGA
TACACAGACGACATTCGCCAGCTGGTGCAACACTTGGATCTCAAGGGGTACTACATTCTCGGTGTCAGCGGCGGG
TCGGCATATACGCTTGCATGCGCAAAGGTTCTGCCTCGCCAACAAGTGCGCGGCGTAGGCATTGGCGTGGGCGTC
GCGCCCTGGCATGCGGGACGCAAAGGTCAGACCCTCAAGACGCTGCTGCAAATGTACATGATGAAATACTGGCCC
GCGCGTCTCTTAAAGGACACGCAAGACACTTATGTCCCCCTGGCGCGAGATGCCGATCCGGCGCCCATGGAGAAT
CGCTTCCGTCAAAACATGCTTCCTTATATGGATGCCGTTGAGGCTGATAAATGGATCAAGACGGATCCCATTCAG
AGCAGCGTGCGCGTCTACCGACAGTACTATGCCCATGGCATTGATGCCCACGTCGACGACATGCGTCTTCTTACA
CGGCCCTGGGGCTTCCGCATCGAGGAGGTTGGCTACGAAGGCGTCAAGCTCTGGTATGGCAGCGCAGACACCAAC
ACGCCCGCAGACATGGGCTTGTATCTTGCTCGCCGCCTGCCCAAGAGCATATATAAGGAGTACGCGGGCGAGACG
CATAGCTCATTGCTTACCAGTGGTCACTTTCGGGGTATTTTAAGCGATCTGATTTCGGATGCGCAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail