Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2016
Gene name
LocationContig_16:104771..106202
Strand+
Gene length (bp)1431
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.3E-29 53 435

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 3 471 6.0E-34

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 124 146 22
3 161 183 22
4 195 217 22
5 241 263 22
6 275 297 22
7 321 343 22
8 364 386 22
9 390 412 22
10 425 447 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2016
MAPLEDDKHASATPHRATDWEAGSKTQEAPQASSSTSISMLDPSSGGSSGLRTLSRRDTILVLITNQVGMGLLSL
PKILQTLGIVPGVLALVAVGGITFYTALELLRFWRVHRQCVSVVDMARVVGGPVLEAIVGVGLVVKVAMTCASAT
VTMTVALNAVSGHGMCTVGFAACAVLACWALCLPRTMKFAAQTGIPSTLCMLAAILVLVVSLGVAGGPRHAPAGP
WQRHIVLFGRPSFNEGIGAFLKVCYAYAGNVAFVSYMAEMRDPSRDFAPALAVLQLFSIVLYLASAIAIYWLSAQ
YTTSPALGSAPLLAAKVAYAIALPALLATGLVFGHAAIKFLYVAVMRAIKATHQLADRSVKSWTAWVVCASFFWL
LTFLLASAVPVFDSILSIASATLIAWFAFGISGVFWFHRNWHVKFKGRNAWFALVNALLILQALFMNGVGLWAAL
RGLIDIFNDKSNKIGGAFTCADNSIF*
Coding >OphauB2|2016
ATGGCACCTCTCGAGGATGACAAGCACGCGTCAGCCACGCCGCACCGCGCCACCGACTGGGAAGCCGGGAGCAAA
ACCCAGGAGGCGCCACAAGCCAGCTCCAGCACCAGCATCAGCATGCTCGACCCCAGCTCCGGCGGCAGCAGCGGC
CTGCGCACGCTGAGCCGGCGGGACACGATTCTCGTCCTCATCACCAACCAAGTCGGCATGGGCCTGCTGTCGCTG
CCCAAGATATTGCAGACGCTGGGCATCGTGCCGGGAGTGCTGGCGCTGGTGGCGGTGGGCGGCATCACGTTTTAC
ACGGCGCTCGAGCTGCTGCGCTTTTGGCGCGTGCACCGGCAGTGCGTCAGCGTCGTCGACATGGCGCGCGTGGTG
GGCGGGCCGGTGCTCGAGGCCATTGTCGGCGTGGGGCTCGTGGTAAAGGTGGCCATGACGTGTGCGTCGGCCACT
GTCACCATGACGGTGGCGCTCAATGCCGTCTCGGGGCATGGCATGTGCACTGTTGGCTTTGCGGCCTGTGCCGTG
CTGGCGTGCTGGGCGCTGTGTCTGCCGCGCACCATGAAGTTTGCGGCGCAGACGGGCATTCCCTCGACCCTGTGC
ATGCTGGCCGCCATTCTCGTCCTTGTTGTTAGCCTTGGGGTTGCCGGCGGGCCGCGGCATGCTCCTGCCGGCCCG
TGGCAGCGCCACATTGTCCTCTTTGGCCGGCCCAGCTTCAACGAGGGCATCGGCGCCTTTCTCAAGGTCTGCTAC
GCCTATGCTGGCAATGTGGCCTTTGTCTCGTACATGGCCGAGATGAGGGACCCGTCGCGCGACTTTGCGCCCGCC
CTGGCCGTCCTGCAGCTCTTTTCCATTGTCCTCTATCTCGCCTCTGCCATTGCCATATACTGGCTGTCGGCACAG
TACACCACGTCGCCCGCGCTCGGCTCCGCGCCGCTGCTTGCTGCAAAGGTGGCATACGCCATCGCCCTGCCTGCC
CTGCTCGCCACGGGGCTCGTCTTTGGCCACGCCGCCATCAAGTTTTTATACGTGGCCGTCATGCGCGCCATCAAG
GCCACTCACCAGCTGGCGGACCGCTCAGTCAAGTCGTGGACCGCATGGGTCGTGTGTGCTTCCTTTTTCTGGCTC
CTCACCTTTTTGCTCGCCAGCGCCGTTCCAGTCTTTGACTCTATTCTCTCCATTGCCTCGGCTACACTCATAGCC
TGGTTTGCCTTTGGCATTAGCGGCGTCTTTTGGTTCCACCGCAACTGGCACGTCAAGTTCAAGGGGCGTAATGCC
TGGTTTGCTCTCGTCAATGCGCTCCTCATCTTGCAGGCCCTCTTTATGAATGGCGTGGGTTTGTGGGCTGCGCTG
CGGGGCTTGATTGATATTTTCAACGACAAGTCCAACAAGATTGGCGGCGCCTTTACTTGTGCCGATAATTCCATA
TTTTAA
Transcript >OphauB2|2016
ATGGCACCTCTCGAGGATGACAAGCACGCGTCAGCCACGCCGCACCGCGCCACCGACTGGGAAGCCGGGAGCAAA
ACCCAGGAGGCGCCACAAGCCAGCTCCAGCACCAGCATCAGCATGCTCGACCCCAGCTCCGGCGGCAGCAGCGGC
CTGCGCACGCTGAGCCGGCGGGACACGATTCTCGTCCTCATCACCAACCAAGTCGGCATGGGCCTGCTGTCGCTG
CCCAAGATATTGCAGACGCTGGGCATCGTGCCGGGAGTGCTGGCGCTGGTGGCGGTGGGCGGCATCACGTTTTAC
ACGGCGCTCGAGCTGCTGCGCTTTTGGCGCGTGCACCGGCAGTGCGTCAGCGTCGTCGACATGGCGCGCGTGGTG
GGCGGGCCGGTGCTCGAGGCCATTGTCGGCGTGGGGCTCGTGGTAAAGGTGGCCATGACGTGTGCGTCGGCCACT
GTCACCATGACGGTGGCGCTCAATGCCGTCTCGGGGCATGGCATGTGCACTGTTGGCTTTGCGGCCTGTGCCGTG
CTGGCGTGCTGGGCGCTGTGTCTGCCGCGCACCATGAAGTTTGCGGCGCAGACGGGCATTCCCTCGACCCTGTGC
ATGCTGGCCGCCATTCTCGTCCTTGTTGTTAGCCTTGGGGTTGCCGGCGGGCCGCGGCATGCTCCTGCCGGCCCG
TGGCAGCGCCACATTGTCCTCTTTGGCCGGCCCAGCTTCAACGAGGGCATCGGCGCCTTTCTCAAGGTCTGCTAC
GCCTATGCTGGCAATGTGGCCTTTGTCTCGTACATGGCCGAGATGAGGGACCCGTCGCGCGACTTTGCGCCCGCC
CTGGCCGTCCTGCAGCTCTTTTCCATTGTCCTCTATCTCGCCTCTGCCATTGCCATATACTGGCTGTCGGCACAG
TACACCACGTCGCCCGCGCTCGGCTCCGCGCCGCTGCTTGCTGCAAAGGTGGCATACGCCATCGCCCTGCCTGCC
CTGCTCGCCACGGGGCTCGTCTTTGGCCACGCCGCCATCAAGTTTTTATACGTGGCCGTCATGCGCGCCATCAAG
GCCACTCACCAGCTGGCGGACCGCTCAGTCAAGTCGTGGACCGCATGGGTCGTGTGTGCTTCCTTTTTCTGGCTC
CTCACCTTTTTGCTCGCCAGCGCCGTTCCAGTCTTTGACTCTATTCTCTCCATTGCCTCGGCTACACTCATAGCC
TGGTTTGCCTTTGGCATTAGCGGCGTCTTTTGGTTCCACCGCAACTGGCACGTCAAGTTCAAGGGGCGTAATGCC
TGGTTTGCTCTCGTCAATGCGCTCCTCATCTTGCAGGCCCTCTTTATGAATGGCGTGGGTTTGTGGGCTGCGCTG
CGGGGCTTGATTGATATTTTCAACGACAAGTCCAACAAGATTGGCGGCGCCTTTACTTGTGCCGATAATTCCATA
TTTTAA
Gene >OphauB2|2016
ATGGCACCTCTCGAGGATGACAAGCACGCGTCAGCCACGCCGCACCGCGCCACCGACTGGGAAGCCGGGAGCAAA
ACCCAGGAGGCGCCACAAGCCAGCTCCAGCACCAGCATCAGCATGCTCGACCCCAGCTCCGGCGGCAGCAGCGGC
CTGCGCACGCTGAGCCGGCGGGACACGATTCTCGTCCTCATCACCAACCAAGTCGGCATGGGCCTGCTGTCGCTG
CCCAAGATATTGCAGACGCTGGGCATCGTGCCGGGAGTGCTGGCGCTGGTGGCGGTGGGCGGCATCACGTTTTAC
ACGGCGCTCGAGCTGCTGCGCTTTTGGCGCGTGCACCGGCAGTGCGTCAGCGTCGTCGACATGGCGCGCGTGGTG
GGCGGGCCGGTGCTCGAGGCCATTGTCGGCGTGGGGCTCGTGGTAAAGGTGGCCATGACGTGTGCGTCGGCCACT
GTCACCATGACGGTGGCGCTCAATGCCGTCTCGGGGCATGGCATGTGCACTGTTGGCTTTGCGGCCTGTGCCGTG
CTGGCGTGCTGGGCGCTGTGTCTGCCGCGCACCATGAAGTTTGCGGCGCAGACGGGCATTCCCTCGACCCTGTGC
ATGCTGGCCGCCATTCTCGTCCTTGTTGTTAGCCTTGGGGTTGCCGGCGGGCCGCGGCATGCTCCTGCCGGCCCG
TGGCAGCGCCACATTGTCCTCTTTGGCCGGCCCAGCTTCAACGAGGGCATCGGCGCCTTTCTCAAGGTCTGCTAC
GCCTATGCTGGCAATGTGGCCTTTGTCTCGTACATGGCCGAGATGAGGGACCCGTCGCGCGACTTTGCGCCCGCC
CTGGCCGTCCTGCAGCTCTTTTCCATTGTCCTCTATCTCGCCTCTGCCATTGCCATATACTGGCTGTCGGCACAG
TACACCACGTCGCCCGCGCTCGGCTCCGCGCCGCTGCTTGCTGCAAAGGTGGCATACGCCATCGCCCTGCCTGCC
CTGCTCGCCACGGGGCTCGTCTTTGGCCACGCCGCCATCAAGTTTTTATACGTGGCCGTCATGCGCGCCATCAAG
GCCACTCACCAGCTGGCGGACCGCTCAGTCAAGTCGTGGACCGCATGGGTCGTGTGTGCTTCCTTTTTCTGGCTC
CTCACCTTTTTGCTCGCCAGCGCCGTTCCAGTCTTTGACTCTATTCTCTCCATTGCCTCGGCTACACTCATAGCC
TGGTTTGCCTTTGGCATTAGCGGCGTCTTTTGGTTCCACCGCAACTGGCACGTCAAGTTCAAGGGGCGTAATGCC
TGGTTTGCTCTCGTCAATGCGCTCCTCATCTTGCAGGCCCTCTTTATGAATGGCGTGGGTTTGTGGGCTGCGCTG
CGGGGCTTGATTGATATTTTCAACGACAAGTCCAACAAGATTGGCGGCGCCTTTACTTGTGCCGATAATTCCATA
TTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail