Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2012
Gene name
LocationContig_16:91505..93008
Strand-
Gene length (bp)1503
Transcript length (bp)1161
Coding sequence length (bp)1161
Protein length (aa) 387

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 6.1E-24 224 364

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 35 383 4.0E-81
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 35 383 6.0E-81
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 55 375 8.0E-29
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 55 375 1.0E-28
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 61 369 3.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 35 383 4.0E-81
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 35 383 6.0E-81
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 55 375 8.0E-29
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 55 375 1.0E-28
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 61 369 3.0E-21
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 224 374 2.0E-20
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 64 366 1.0E-19
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 65 369 3.0E-19
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 54 369 5.0E-18
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 225 371 6.0E-18
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 80 369 6.0E-18
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 93 364 2.0E-17
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 77 371 3.0E-17
sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 93 365 4.0E-17
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 93 365 7.0E-17
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 65 382 7.0E-17
sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 93 365 7.0E-17
sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 93 365 8.0E-17
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 65 364 1.0E-16
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 97 369 1.0E-16
sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 93 365 2.0E-16
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 93 375 2.0E-16
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 61 369 6.0E-16
sp|Q6T1F5|COMT1_AMMMJ Caffeic acid 3-O-methyltransferase OS=Ammi majus GN=COMT PE=1 SV=1 94 365 7.0E-16
sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 93 365 7.0E-16
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 224 371 1.0E-15
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 49 383 2.0E-15
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 93 369 2.0E-15
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 93 382 3.0E-15
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 93 365 4.0E-15
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 73 369 4.0E-15
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 73 369 4.0E-15
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 93 365 7.0E-15
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 225 369 1.0E-14
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 225 382 1.0E-14
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 225 382 1.0E-14
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 225 367 1.0E-14
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 73 369 1.0E-14
sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 93 358 2.0E-14
sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 93 365 2.0E-14
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 225 367 3.0E-14
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 93 365 4.0E-14
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 93 365 4.0E-14
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 93 368 4.0E-14
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 225 365 9.0E-14
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 225 369 2.0E-13
sp|O82054|COMT1_SACOF Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1 68 364 2.0E-13
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 225 364 3.0E-13
sp|Q06509|COMT1_MAIZE Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1 225 364 4.0E-13
sp|Q39522|SMT_COPJA (S)-scoulerine 9-O-methyltransferase OS=Coptis japonica GN=SMT PE=1 SV=1 92 364 6.0E-13
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 80 369 1.0E-12
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 97 369 2.0E-12
sp|Q9SWC2|COMT1_EUCGL Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1 93 351 3.0E-12
sp|O24305|M3OM1_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 65 369 3.0E-12
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 225 367 4.0E-12
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 225 365 5.0E-12
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 96 372 6.0E-12
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 65 365 8.0E-12
sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 225 376 1.0E-11
sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 225 383 2.0E-11
sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 225 376 8.0E-11
sp|A8QW53|OMT3_SORBI 5-pentadecatrienyl resorcinol O-methyltransferase OS=Sorghum bicolor GN=OMT3 PE=1 SV=1 225 383 2.0E-10
sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 225 372 6.0E-10
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 65 369 7.0E-10
sp|Q6ZD89|OMT1_ORYSJ Flavone 3'-O-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=ROMT-9 PE=1 SV=1 243 364 8.0E-10
sp|Q84N28|FOMT1_WHEAT Flavone O-methyltransferase 1 OS=Triticum aestivum GN=OMT1 PE=1 SV=1 242 365 2.0E-09
sp|P47917|ZRP4_MAIZE O-methyltransferase ZRP4 OS=Zea mays GN=ZRP4 PE=2 SV=1 225 383 3.0E-09
sp|P45986|IMT1_MESCR Inositol 4-methyltransferase OS=Mesembryanthemum crystallinum GN=IMT1 PE=1 SV=1 218 364 3.0E-09
sp|P0DH60|M3OM2_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 2 OS=Pisum sativum GN=HMM2 PE=1 SV=1 77 369 1.0E-08
sp|A9X7L0|ANMT_RUTGR Anthranilate N-methyltransferase OS=Ruta graveolens PE=1 SV=1 225 365 2.0E-08
sp|Q0IP69|NOMT_ORYSJ Naringenin 7-O-methyltransferase OS=Oryza sativa subsp. japonica GN=Os12g0240900 PE=1 SV=2 243 373 2.0E-08
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 74 364 4.0E-08
sp|B1P123|BX7_MAIZE TRIBOA-glucoside O-methyltransferase BX7 OS=Zea mays GN=BX7 PE=1 SV=1 215 383 7.0E-08
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 225 371 2.0E-07
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 224 364 3.0E-07
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 224 364 4.0E-07
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 225 369 5.0E-07
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 224 365 5.0E-07
sp|Q29U70|I4OMT_MEDTR Isoflavone 4'-O-methyltransferase OS=Medicago truncatula GN=HI4'OMT PE=1 SV=1 241 369 7.0E-07
sp|B8RCD3|AIMT1_PIMAN Trans-anol O-methyltransferase 1 OS=Pimpinella anisum GN=AIMT1 PE=1 SV=1 225 364 9.0E-07
sp|Q54FP4|OMT10_DICDI O-methyltransferase 10 OS=Dictyostelium discoideum GN=omt10 PE=3 SV=2 274 372 1.0E-06
sp|Q84KK4|I4OMT_LOTJA Isoflavone 4'-O-methyltransferase OS=Lotus japonicus GN=HI4'OMT PE=1 SV=1 65 369 2.0E-06
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 224 365 2.0E-06
sp|B3GSH5|ASMT_RAT Acetylserotonin O-methyltransferase OS=Rattus norvegicus GN=Asmt PE=1 SV=1 224 367 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2012
MERKSYKTELDALIQSLRQVAGESEEARYDTAHALRDLRRSLATPDDTYDRFEKANLEISVSCIAQDLELYQTLA
ENHEPMSVDALSARVGAAPLLLRRILRFLASVGQLSETAPDTFAANAETRTLASPAFRGLTYHTFHTIIPLLQGL
PSFLASRKYRDITSITDTAAQHVFDMSLPAFSWLPTQPKRFEYLQQFMPAQPHGATWFSVYSLRPHLGDNDDVVL
VDVGGGFGHQCAQLMEAYPELKGKLVLQDMQQALEQAPPLEGVKTMAHDFFTKQPVKGARLYYLRHIMHDWPDDK
CLLILKHLRDAMGPKSLILIDDIVMPNAGAHERATAIDLIVMASFGAMERTVDDWRALLTAAGLRIQRIDTYFSR
RHSSIIQVGVL*
Coding >OphauB2|2012
ATGGAAAGAAAATCTTACAAGACAGAACTCGATGCTCTAATCCAGAGCCTGCGTCAAGTGGCTGGCGAGAGCGAG
GAGGCTCGATATGACACGGCGCATGCCCTGCGTGACTTGCGCCGCTCCCTCGCTACGCCTGATGATACCTATGAC
CGCTTCGAGAAGGCGAACCTCGAGATTTCTGTCTCGTGCATCGCTCAGGATCTAGAGCTGTACCAGACTCTGGCG
GAGAATCATGAGCCCATGAGCGTGGACGCGCTGTCGGCCAGGGTTGGAGCGGCACCTCTACTATTGCGCCGCATC
TTGCGCTTCCTAGCCTCAGTCGGCCAGCTCTCAGAAACAGCCCCCGACACCTTTGCCGCCAATGCCGAAACAAGG
ACTCTCGCCTCGCCCGCTTTTCGCGGCCTCACCTACCACACCTTCCACACCATTATCCCCCTCCTCCAAGGCCTG
CCCAGCTTCCTCGCCAGCCGCAAATACCGCGACATCACCAGCATCACCGACACGGCCGCCCAGCACGTCTTTGAC
ATGTCGCTACCCGCCTTTAGCTGGTTGCCCACCCAGCCCAAACGTTTCGAGTACCTGCAGCAGTTCATGCCCGCC
CAGCCACACGGCGCAACTTGGTTTTCCGTCTACTCCTTGCGTCCGCACCTCGGGGACAACGACGACGTGGTTCTG
GTTGACGTGGGCGGTGGCTTCGGCCACCAGTGTGCGCAGCTCATGGAAGCCTATCCCGAGCTCAAGGGCAAGCTG
GTCCTCCAGGACATGCAGCAGGCGCTTGAGCAGGCGCCGCCGCTGGAAGGCGTCAAGACCATGGCACACGACTTC
TTCACCAAACAACCCGTCAAGGGCGCGCGCCTCTATTACTTGAGGCACATTATGCACGACTGGCCCGACGACAAG
TGCCTGCTCATCCTCAAACACCTCAGGGATGCCATGGGACCCAAGTCGCTCATTCTGATTGATGATATTGTCATG
CCTAATGCTGGCGCCCATGAGCGTGCCACGGCGATTGACCTCATCGTCATGGCGTCCTTTGGTGCCATGGAGCGC
ACTGTGGATGATTGGCGCGCCCTGCTTACGGCTGCCGGCTTGCGCATCCAACGCATCGACACTTATTTTTCTCGC
CGTCACAGCTCCATTATACAGGTTGGGGTCCTGTAG
Transcript >OphauB2|2012
ATGGAAAGAAAATCTTACAAGACAGAACTCGATGCTCTAATCCAGAGCCTGCGTCAAGTGGCTGGCGAGAGCGAG
GAGGCTCGATATGACACGGCGCATGCCCTGCGTGACTTGCGCCGCTCCCTCGCTACGCCTGATGATACCTATGAC
CGCTTCGAGAAGGCGAACCTCGAGATTTCTGTCTCGTGCATCGCTCAGGATCTAGAGCTGTACCAGACTCTGGCG
GAGAATCATGAGCCCATGAGCGTGGACGCGCTGTCGGCCAGGGTTGGAGCGGCACCTCTACTATTGCGCCGCATC
TTGCGCTTCCTAGCCTCAGTCGGCCAGCTCTCAGAAACAGCCCCCGACACCTTTGCCGCCAATGCCGAAACAAGG
ACTCTCGCCTCGCCCGCTTTTCGCGGCCTCACCTACCACACCTTCCACACCATTATCCCCCTCCTCCAAGGCCTG
CCCAGCTTCCTCGCCAGCCGCAAATACCGCGACATCACCAGCATCACCGACACGGCCGCCCAGCACGTCTTTGAC
ATGTCGCTACCCGCCTTTAGCTGGTTGCCCACCCAGCCCAAACGTTTCGAGTACCTGCAGCAGTTCATGCCCGCC
CAGCCACACGGCGCAACTTGGTTTTCCGTCTACTCCTTGCGTCCGCACCTCGGGGACAACGACGACGTGGTTCTG
GTTGACGTGGGCGGTGGCTTCGGCCACCAGTGTGCGCAGCTCATGGAAGCCTATCCCGAGCTCAAGGGCAAGCTG
GTCCTCCAGGACATGCAGCAGGCGCTTGAGCAGGCGCCGCCGCTGGAAGGCGTCAAGACCATGGCACACGACTTC
TTCACCAAACAACCCGTCAAGGGCGCGCGCCTCTATTACTTGAGGCACATTATGCACGACTGGCCCGACGACAAG
TGCCTGCTCATCCTCAAACACCTCAGGGATGCCATGGGACCCAAGTCGCTCATTCTGATTGATGATATTGTCATG
CCTAATGCTGGCGCCCATGAGCGTGCCACGGCGATTGACCTCATCGTCATGGCGTCCTTTGGTGCCATGGAGCGC
ACTGTGGATGATTGGCGCGCCCTGCTTACGGCTGCCGGCTTGCGCATCCAACGCATCGACACTTATTTTTCTCGC
CGTCACAGCTCCATTATACAGGTTGGGGTCCTGTAG
Gene >OphauB2|2012
ATGGAAAGAAAATCTTACAAGACAGAACTCGATGCTCTAATCCAGAGCCTGCGTCAAGTGGCTGGCGAGAGCGAG
GAGGCTCGATATGACACGGCGCATGCCCTGCGTGACTTGCGCCGCTCCCTCGCTACGCCTGATGATACCTATGAC
CGCTTCGAGAAGGCGAACCTCGAGATTTCTGTCTCGTGCATCGCTCAGGATCTAGAGCTGTACCAGACTCTGGCG
GAGAATCATGAGCCCATGAGCGTGGACGCGCTGTCGGCCAGGGTTGGAGCGGCACCTCTACTATTGCGTAGGTCT
ATTCCTGTCTTTTTATTCTTGGTGACTCTCTCTTTCTCTTCTCTTTTCCATCCTCTTGCTTCTCTCTTCTCTTAC
CCACCCTCTTACTTTTCTCTCTCTCTCTTCTGTTATCCACCCTCTTACTTTTCTCTCTCTCTCTCTCTCCTCCCT
CACCTATACTCTCACTCCTCTCTTCCTTTTCTCACCTCTCCCCTCACTCCTCTCTCTTCCTCTTCTCACCTCTCC
CCTCACTCCTCTCTCTCTCTCTCTCTCCATCTTCTCATCTCTCTCTACCGGCAGCTTGTAGTTTCGAAGCCCAGC
AACTGACAAACATGCCCGGCTGACAATTTCAAAGGCCGCATCTTGCGCTTCCTAGCCTCAGTCGGCCAGCTCTCA
GAAACAGCCCCCGACACCTTTGCCGCCAATGCCGAAACAAGGACTCTCGCCTCGCCCGCTTTTCGCGGCCTCACC
TACCACACCTTCCACACCATTATCCCCCTCCTCCAAGGCCTGCCCAGCTTCCTCGCCAGCCGCAAATACCGCGAC
ATCACCAGCATCACCGACACGGCCGCCCAGCACGTCTTTGACATGTCGCTACCCGCCTTTAGCTGGTTGCCCACC
CAGCCCAAACGTTTCGAGTACCTGCAGCAGTTCATGCCCGCCCAGCCACACGGCGCAACTTGGTTTTCCGTCTAC
TCCTTGCGTCCGCACCTCGGGGACAACGACGACGTGGTTCTGGTTGACGTGGGCGGTGGCTTCGGCCACCAGTGT
GCGCAGCTCATGGAAGCCTATCCCGAGCTCAAGGGCAAGCTGGTCCTCCAGGACATGCAGCAGGCGCTTGAGCAG
GCGCCGCCGCTGGAAGGCGTCAAGACCATGGCACACGACTTCTTCACCAAACAACCCGTCAAGGGCGCGCGCCTC
TATTACTTGAGGCACATTATGCACGACTGGCCCGACGACAAGTGCCTGCTCATCCTCAAACACCTCAGGGATGCC
ATGGGACCCAAGTCGCTCATTCTGATTGATGATATTGTCATGCCTAATGCTGGCGCCCATGAGCGTGCCACGGCG
ATTGACCTCATCGTCATGGCGTCCTTTGGTGCCATGGAGCGCACTGTGGATGATTGGCGCGCCCTGCTTACGGCT
GCCGGCTTGCGCATCCAACGCATCGACACTTATTTTTCTCGCCGTCACAGCTCCATTATACAGGTTGGGGTCCTG
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail