Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1997
Gene name
LocationContig_16:51295..52501
Strand+
Gene length (bp)1206
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 5.2E-21 163 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47163|EFM3_YEAST Protein-lysine N-methyltransferase EFM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM3 PE=1 SV=2 143 327 7.0E-21
sp|Q96G04|EF2KT_HUMAN Protein-lysine N-methyltransferase EEF2KMT OS=Homo sapiens GN=EEF2KMT PE=1 SV=2 50 350 9.0E-20
sp|O14118|EFM3_SCHPO Protein-lysine N-methyltransferase efm3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.03 PE=3 SV=3 148 317 2.0E-19
sp|Q3UZW7|EF2KT_MOUSE Protein-lysine N-methyltransferase EEF2KMT OS=Mus musculus GN=Eef2kmt PE=1 SV=1 64 317 4.0E-16
sp|Q8N7N1|F86B1_HUMAN Putative protein N-methyltransferase FAM86B1 OS=Homo sapiens GN=FAM86B1 PE=2 SV=2 161 332 8.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47163|EFM3_YEAST Protein-lysine N-methyltransferase EFM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM3 PE=1 SV=2 143 327 7.0E-21
sp|Q96G04|EF2KT_HUMAN Protein-lysine N-methyltransferase EEF2KMT OS=Homo sapiens GN=EEF2KMT PE=1 SV=2 50 350 9.0E-20
sp|O14118|EFM3_SCHPO Protein-lysine N-methyltransferase efm3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.03 PE=3 SV=3 148 317 2.0E-19
sp|Q3UZW7|EF2KT_MOUSE Protein-lysine N-methyltransferase EEF2KMT OS=Mus musculus GN=Eef2kmt PE=1 SV=1 64 317 4.0E-16
sp|Q8N7N1|F86B1_HUMAN Putative protein N-methyltransferase FAM86B1 OS=Homo sapiens GN=FAM86B1 PE=2 SV=2 161 332 8.0E-16
sp|P0C5J1|F86B2_HUMAN Putative protein N-methyltransferase FAM86B2 OS=Homo sapiens GN=FAM86B2 PE=1 SV=1 64 332 1.0E-15
sp|P30643|YNE4_CAEEL Uncharacterized protein R08D7.4 OS=Caenorhabditis elegans GN=R08D7.4 PE=4 SV=3 43 344 1.0E-15
sp|Q1JPJ9|EF2KT_BOVIN Protein-lysine N-methyltransferase EEF2KMT OS=Bos taurus GN=EEF2KMT PE=2 SV=2 64 355 1.0E-14
sp|Q86JB0|Y8324_DICDI Putative uncharacterized protein DDB_G0277003 OS=Dictyostelium discoideum GN=DDB_G0277003 PE=4 SV=2 158 355 2.0E-12
sp|A4FV98|MT21B_BOVIN Protein-lysine methyltransferase METTL21B OS=Bos taurus GN=METTL21B PE=2 SV=1 166 342 8.0E-10
sp|P0CP44|NNT1_CRYNJ Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NNT1 PE=3 SV=1 164 341 2.0E-09
sp|P0CP45|NNT1_CRYNB Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NNT1 PE=3 SV=1 164 341 2.0E-09
sp|Q28IN4|MT21B_XENTR Protein-lysine methyltransferase METTL21B OS=Xenopus tropicalis GN=mettl21b PE=2 SV=1 168 355 3.0E-08
sp|Q96AZ1|MT21B_HUMAN Protein-lysine methyltransferase METTL21B OS=Homo sapiens GN=METTL21B PE=1 SV=1 166 358 5.0E-08
sp|Q5RJL2|MET23_RAT Methyltransferase-like protein 23 OS=Rattus norvegicus GN=Mettl23 PE=2 SV=1 164 310 8.0E-08
sp|A2AA28|MET23_MOUSE Methyltransferase-like protein 23 OS=Mus musculus GN=Mettl23 PE=2 SV=1 164 310 1.0E-06
sp|Q6DJF8|MET23_XENLA Methyltransferase-like protein 23 OS=Xenopus laevis GN=mettl23 PE=2 SV=1 164 310 1.0E-06
sp|Q8WXB1|MT21A_HUMAN Protein N-lysine methyltransferase METTL21A OS=Homo sapiens GN=METTL21A PE=1 SV=2 168 317 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1997
MAAGTGSSGAGMHTAESSWIRQVHRLRHQYFQQEAVLDLPTPEVIRLAEVQDAIYSQLFDEHVVVHCPPKRYQAK
VLKQLVARIEAAIVDWDTYAVSDSLMTSLAELMCTPMPLESAVIQEKSTVIYHLSQLDYSGRDSVETEEEPCIIL
LESRFLLSAAGTTGLRTWEAALHLGQYLSQYPQVVAGRRVLELGAGTGYLSMLCAKYLSPTHVTLSDGSDNVVAN
FSNNLLLNRLEEDPSRITFVKLIWGHPLIGADAQWIKGQPVDVILGADVTYDRSAIPALVASLAEILGMYVHAQA
YVAITRRSEDNFSAFLETCLQHKLGLENLQYEILPRARQEGPFYCDQVEVRVYRIQHKIKSNSKEAASGSCR*
Coding >OphauB2|1997
ATGGCTGCTGGAACGGGCTCTTCTGGCGCTGGCATGCACACGGCTGAATCCTCGTGGATTCGTCAAGTGCATCGC
TTGCGCCATCAGTACTTTCAACAAGAAGCTGTCTTGGACCTTCCGACACCGGAGGTCATCAGGCTCGCCGAGGTG
CAGGATGCCATTTATTCGCAGCTCTTTGACGAGCATGTCGTGGTACACTGCCCACCAAAACGATATCAGGCCAAA
GTGCTCAAACAGCTCGTGGCGCGAATAGAAGCTGCCATTGTCGACTGGGATACGTATGCAGTGTCTGACAGTCTG
ATGACGTCTCTCGCAGAGCTCATGTGTACTCCCATGCCATTAGAATCAGCAGTAATACAGGAAAAGAGCACCGTC
ATATATCATCTTTCGCAACTGGACTACTCTGGTCGAGACTCGGTCGAGACAGAAGAAGAGCCTTGCATCATCCTG
TTGGAAAGCCGCTTTCTCCTCTCTGCAGCCGGAACGACGGGGCTACGAACGTGGGAAGCTGCCCTCCATCTTGGC
CAATATTTGTCCCAATACCCGCAAGTGGTTGCTGGCAGACGCGTGCTCGAGCTCGGAGCTGGCACTGGATATCTG
TCCATGCTATGTGCCAAATACCTCTCGCCCACACACGTCACCTTGTCTGATGGGTCTGACAATGTAGTTGCCAAC
TTTTCAAACAACTTGCTCCTCAATAGGCTTGAGGAGGACCCGTCGCGCATTACATTTGTCAAGCTCATCTGGGGC
CACCCCTTGATCGGTGCAGATGCGCAGTGGATCAAAGGCCAGCCTGTCGACGTCATCCTGGGCGCCGACGTGACC
TACGATCGGAGTGCCATCCCGGCACTGGTCGCATCTCTGGCTGAAATACTTGGCATGTATGTGCATGCTCAGGCG
TATGTCGCCATTACACGGCGAAGCGAAGACAACTTTAGTGCATTCTTGGAAACTTGCCTCCAGCACAAACTCGGC
TTGGAAAACTTGCAATACGAGATTTTGCCACGTGCTAGACAAGAAGGACCATTTTATTGTGACCAAGTTGAAGTG
CGCGTTTACCGGATACAACACAAAATCAAGAGTAATTCTAAAGAGGCAGCAAGCGGCTCGTGTCGATAA
Transcript >OphauB2|1997
ATGGCTGCTGGAACGGGCTCTTCTGGCGCTGGCATGCACACGGCTGAATCCTCGTGGATTCGTCAAGTGCATCGC
TTGCGCCATCAGTACTTTCAACAAGAAGCTGTCTTGGACCTTCCGACACCGGAGGTCATCAGGCTCGCCGAGGTG
CAGGATGCCATTTATTCGCAGCTCTTTGACGAGCATGTCGTGGTACACTGCCCACCAAAACGATATCAGGCCAAA
GTGCTCAAACAGCTCGTGGCGCGAATAGAAGCTGCCATTGTCGACTGGGATACGTATGCAGTGTCTGACAGTCTG
ATGACGTCTCTCGCAGAGCTCATGTGTACTCCCATGCCATTAGAATCAGCAGTAATACAGGAAAAGAGCACCGTC
ATATATCATCTTTCGCAACTGGACTACTCTGGTCGAGACTCGGTCGAGACAGAAGAAGAGCCTTGCATCATCCTG
TTGGAAAGCCGCTTTCTCCTCTCTGCAGCCGGAACGACGGGGCTACGAACGTGGGAAGCTGCCCTCCATCTTGGC
CAATATTTGTCCCAATACCCGCAAGTGGTTGCTGGCAGACGCGTGCTCGAGCTCGGAGCTGGCACTGGATATCTG
TCCATGCTATGTGCCAAATACCTCTCGCCCACACACGTCACCTTGTCTGATGGGTCTGACAATGTAGTTGCCAAC
TTTTCAAACAACTTGCTCCTCAATAGGCTTGAGGAGGACCCGTCGCGCATTACATTTGTCAAGCTCATCTGGGGC
CACCCCTTGATCGGTGCAGATGCGCAGTGGATCAAAGGCCAGCCTGTCGACGTCATCCTGGGCGCCGACGTGACC
TACGATCGGAGTGCCATCCCGGCACTGGTCGCATCTCTGGCTGAAATACTTGGCATGTATGTGCATGCTCAGGCG
TATGTCGCCATTACACGGCGAAGCGAAGACAACTTTAGTGCATTCTTGGAAACTTGCCTCCAGCACAAACTCGGC
TTGGAAAACTTGCAATACGAGATTTTGCCACGTGCTAGACAAGAAGGACCATTTTATTGTGACCAAGTTGAAGTG
CGCGTTTACCGGATACAACACAAAATCAAGAGTAATTCTAAAGAGGCAGCAAGCGGCTCGTGTCGATAA
Gene >OphauB2|1997
ATGGCTGCTGGAACGGGCTCTTCTGGCGCTGGCATGCACACGGCTGAATCCTCGTGGATTCGTCAAGTGCATCGC
TTGCGCCATCAGTACTTTCAACAAGAAGCTGTCTTGGACCTTCCGACACCGGAGGTCATCAGGCTCGCCGAGGTG
CAGGATGCCATTTATTCGCAGCTCTTTGACGAGCATGTCGTGGTACACTGCCCACCAAAACGATATCAGGCCAAA
GTGCTCAAACAGCTCGTGGCGCGAATAGAAGCTGCCATTGTCGACTGGGATACGTATGTGAGTGTGCAAATACTC
TCGATTCGTTTCTCAGTACTGGTACTTTTTCGGTGTACGATGTTCATCTCTGATCGACTTGCTCTCTAGGCAGTG
TCTGACAGTCTGATGACGTCTCTCGCAGAGCTCATGTGTACTCCCATGCCATTAGAATCAGCAGTAATACAGGAA
AAGAGCACCGTCATATATCATCTTTCGCAACTGGACTACTCTGGTCGAGACTCGGTCGAGACAGAAGAAGAGCCT
TGCATCATCCTGTTGGAAAGCCGCTTTCTCCTCTCTGCAGCCGGAACGACGGGGCTACGAACGTGGGAAGCTGCC
CTCCATCTTGGCCAATATTTGTCCCAATACCCGCAAGTGGTTGCTGGCAGACGCGTGCTCGAGCTCGGAGCTGGC
ACTGGATATCTGTCCATGCTATGTGCCAAATACCTCTCGCCCACACACGTCACCTTGTCTGATGGGTCTGACAAT
GTAGTTGCCAACTTTTCAAACAACTTGCTCCTCAATAGGCTTGAGGAGGACCCGTCGCGCATTACATTTGTCAAG
CTCATCTGGGGCCACCCCTTGATCGGTGCAGATGCGCAGTGGATCAAAGGCCAGCCTGTCGACGTCATCCTGGGC
GCCGACGTGACCTACGATCGGAGTGCCATCCCGGCACTGGTCGCATCTCTGGCTGAAATACTTGGCATGTATGTG
CATGCTCAGGCGTATGTCGCCATTACACGGCGAAGCGAAGACAACTTTAGTGCATTCTTGGAAACTTGCCTCCAG
CACAAACTCGGCTTGGAAAACTTGCAATACGAGATTTTGCCACGTGCTAGACAAGAAGGACCATTTTATTGTGAC
CAAGTTGAAGTGCGCGTTTACCGGATACAACACAAAATCAAGAGTAATTCTAAAGAGGCAGCAAGCGGCTCGTGT
CGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail